KEGG   Colwellia sp. PAMC 20917: A3Q34_01390Help
Entry
A3Q34_01390       CDS       T04511                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
coz  Colwellia sp. PAMC 20917
Pathway
coz00010  Glycolysis / Gluconeogenesis
coz00030  Pentose phosphate pathway
coz00051  Fructose and mannose metabolism
coz00052  Galactose metabolism
coz00680  Methane metabolism
coz01100  Metabolic pathways
coz01110  Biosynthesis of secondary metabolites
coz01120  Microbial metabolism in diverse environments
coz01130  Biosynthesis of antibiotics
coz01200  Carbon metabolism
coz01230  Biosynthesis of amino acids
coz03018  RNA degradation
Module
coz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:coz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3Q34_01390
   00030 Pentose phosphate pathway
    A3Q34_01390
   00051 Fructose and mannose metabolism
    A3Q34_01390
   00052 Galactose metabolism
    A3Q34_01390
  09102 Energy metabolism
   00680 Methane metabolism
    A3Q34_01390
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    A3Q34_01390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:coz01009]
    A3Q34_01390
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:coz03019]
    A3Q34_01390
Enzymes [BR:coz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A3Q34_01390
Protein phosphatases and associated proteins [BR:coz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A3Q34_01390
Messenger RNA biogenesis [BR:coz03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     A3Q34_01390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AOW75644
UniProt: A0A1D8RRB9
LinkDB All DBs
Position
310789..311793
Genome map
AA seq 334 aa AA seqDB search
MTIKNIAVLTSGGDAPGMNAAIRAVVLAAHHYALPTIGFFSGYNGLIEASSTLLTPASVN
GIIHRGGTILKSARCPAMLTEQGLKSAAATLRKEQIDALIVIGGDGSFNGLLALNKYWSG
AIIGIPGTIDNDIDGTDFTIGFSTAVNTGIEAIDKIRDTAEAFERIFIVEVMGRRSGHIT
FNVGIASAAEQILSFENFSQADEQEKLSHLAKEIKQAQHNRHASYIIVIAENLWPGGAVQ
LAKQLKQTANIDCTACILGYIQRGGSPVAKDRILATKMGVAAVQALIAGKSNVMIGERNN
QLLTVPLDIAVQHKEKVSESLVSAQENILALTAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaaaaatattgcagtattaaccagtggtggcgatgctcccggcatgaatgcg
gcgatacgtgcggtcgtacttgctgcgcatcactatgcattgcccacgattggttttttt
tctggttataacggtttaattgaagcaagttcgacattgctaacacctgcaagtgttaat
ggcattatccaccgaggaggcactattttaaaaagtgctcgctgccccgccatgctcact
gagcaaggtttaaaatcagccgcagcaacccttagaaaagaacaaatagacgccttaatc
gttattggcggcgatggctcttttaacggcttactggcgttaaataaatattggtcagga
gctattataggtattccagggaccatagataatgatattgatggtacagatttcaccatc
ggcttttctactgcagtcaataccggtattgaagcgatagataaaatacgtgacacggca
gaagcttttgagcgaatttttattgttgaagtcatgggcaggcgaagtggacacatcact
tttaatgtcggtatcgccagtgcagctgagcaaatattatcttttgagaatttttctcaa
gccgacgagcaagaaaaactcagtcatttagctaaagaaatcaaacaagcacagcacaat
aggcatgccagttatattatagttattgctgagaacttatggcccggtggcgctgtacag
ctcgctaagcaattaaaacagaccgcaaacattgactgtactgcatgtatacttggctat
attcaacgaggtggttcaccggtagctaaagaccgaattttagcaacaaaaatgggggtt
gctgcagtacaagcgctaatagcaggaaagagtaacgttatgattggcgaacgtaataat
caattactcacagtccctctggacatagccgttcaacataaagaaaaagtcagtgaaagc
ttagtttcagcacaagaaaatattctcgccttaacggcgcagtaa

DBGET integrated database retrieval system