KEGG   Colwellia sp. PAMC 20917: A3Q34_07595Help
Entry
A3Q34_07595       CDS       T04511                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
coz  Colwellia sp. PAMC 20917
Brite
KEGG Orthology (KO) [BR:coz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3Q34_07595
Enzymes [BR:coz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A3Q34_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_oxidored Thi4 NAD_binding_8 DAO FAD_binding_2 NAD_binding_7 Lycopene_cycl FAD_binding_3 K_oxygenase AlaDh_PNT_C Thioredoxin_4 3HCDH_N Str_synth PALP RgpF DUF4891
Motif
Other DBs
NCBI-ProteinID: AOW76725
UniProt: A0A1D8RUC8
LinkDB All DBs
Position
complement(1792647..1794212)
Genome map
AA seq 521 aa AA seqDB search
MLSEDILNAVKAYTQNMTNKVSLVLQTGEHQKRNELKEFLTQLTSVSDNLLLVERDDGLR
SPITFYLEIDGNNNGIHFSGIPSGHEFNSLILAILQSSGTELKLDSTLTKMVQKIKEDLH
FEVFISLSCHNCPDVVQSLNQFALLNEGISSEMIDGGLFKHLIDERNIQGVPSVYLNGEL
FANGKIDTGQLVDKLIERFPYIVGGDDNEQLPLQDITVIGAGPAGVAAAIYAARKGLKVT
IIADRFGGQVKDTVGIENLISVSKTTGTQLTGNMQAHLNDYEITTREFVRVEKIDKGEPE
SKVPKKLHLSSGEVIESKTVIIATGAKWRELGIPGEKENIGSGVAYCPHCDGPFFKGKDV
AVVGGGNSGIEAALDLASMVNHVTVFEFLPGLKADKILVEKAEAHKKITIIKNVATKEVI
AEGGKVVALAYEDRATGEMKQQSLSGIFIQIGLLPNSDFLQGVVECTKYGEVIIDEKCQT
SEPGIFAAGDVSTVPYKQIVIAMGEGSKASLSAFDYLIRES
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtgaagatattttaaatgcagtaaaagcttatacccaaaatatgaccaacaaa
gtatcactagttttacagacgggtgaacatcaaaaacgcaacgaattaaaagaattttta
acacagttaacctcagtatcagacaatctactactggttgaacgcgatgatggtttacgc
agcccaattacgttctacttagaaattgacggtaacaataatggcatccacttttctggt
attcccagtggacatgaatttaattcgttgatattagccattttacagtcatcgggtacc
gaactgaaattagacagcaccttgactaaaatggtgcaaaaaatcaaagaagatttgcac
tttgaagtatttatttccttaagttgccataactgtcctgatgttgtgcaatcgttgaat
cagtttgccttattaaacgaaggtatcagcagtgaaatgattgatggtggcttatttaag
cacttaatagacgaacgtaatattcaaggtgtaccgagtgtttaccttaatggcgaatta
tttgcgaatggaaaaatagacacaggtcaattagtcgataaacttatcgaacgtttccct
tatattgtcggtggcgatgacaacgagcagttaccgttacaagatattaccgttataggc
gcaggtcctgccggtgttgctgctgctatttatgccgctcgtaaaggtttgaaagtgact
attattgctgaccgttttggtggtcaggtcaaagataccgtaggtattgagaacttaatt
tcagtctctaaaacgaccggcacacaactaacgggtaatatgcaagcgcacttaaatgat
tacgagatcacgacaagagagtttgtacgtgttgaaaaaattgataaaggtgagcctgag
agcaaagtaccgaaaaagctacatctttctagtggcgaagttatcgaatctaaaacggtg
atcattgctactggggctaaatggcgtgaacttggtataccaggagaaaaagaaaatatt
ggttctggtgtcgcttattgtccacattgtgatggcccatttttcaaaggtaaagatgtt
gctgtggttggtggtggtaactcaggaatagaagcggcattagatttagcaagtatggtt
aatcatgttaccgtcttcgaattcttacctggcttgaaagcagataaaatattggtagaa
aaagcggaagcgcataaaaagataaccatcattaaaaatgttgctactaaagaagtgatt
gctgaaggtggtaaagttgttgctctggcttatgaagatagagcaacaggggagatgaag
caacaaagcttgtcgggaatatttatccaaataggcttattacccaacagtgatttttta
cagggtgttgttgaatgtactaaatatggcgaagtcatcattgacgaaaaatgtcagacc
tctgagccgggtatatttgctgctggagatgtttctaccgtgccttataagcaaattgtt
attgcgatgggtgagggttcaaaagcatccttgtcagcattcgattatcttattagagaa
agttaa

DBGET integrated database retrieval system