KEGG   Colwellia sp. PAMC 20917: A3Q34_11665Help
Entry
A3Q34_11665       CDS       T04511                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
coz  Colwellia sp. PAMC 20917
Pathway
coz00250  Alanine, aspartate and glutamate metabolism
coz00410  beta-Alanine metabolism
coz00430  Taurine and hypotaurine metabolism
coz00650  Butanoate metabolism
coz01100  Metabolic pathways
coz01110  Biosynthesis of secondary metabolites
coz01120  Microbial metabolism in diverse environments
coz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:coz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    A3Q34_11665
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A3Q34_11665
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3Q34_11665
   00430 Taurine and hypotaurine metabolism
    A3Q34_11665
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    A3Q34_11665
Enzymes [BR:coz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A3Q34_11665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF763
Motif
Other DBs
NCBI-ProteinID: AOW77458
UniProt: A0A1D8RWI4
LinkDB All DBs
Position
2708275..2709903
Genome map
AA seq 542 aa AA seqDB search
MTTNKRTAKATQESLHSIFTIPEAPDSTLGLIEKEISENLAGFLGNHIAAKERALSEIEK
DFASSAIPEEPSFVSDHTRHILDKVVAQSVHTSSPSFIGHMTSALPYFILPLSKLMVGLN
QNLVKIETSKAFTPLERQVLGMMHRLVYKDNDHFYEQWMHSANHSLGAFCSGGTVANLTA
FWVARNNLLKADGDFKGIAREGLFNALKHYKYDGLVILVSDRGHYSLKKSADILGIGQDS
VISIPTDGHNRIDCQKLREKCLELKQRNIRVLSIVGVAGTTETGNIDPLDKMADIAEEFQ
THFHVDAAWGGATLLSNKYRPLLKGIERADSVTIDAHKQMYVPMGAGLVVFKNPASVASI
EHHAEYILRKGSKDLGSHTLEGSRPGMAMLVYASLHIISRPGYEMLINQGIDRARYFAER
INQHADFELITEPELCLLTYRYNPKAVQNLLANSSAEQQDKINDLLDDLTKFIQKRQREN
GKSFVSRTRIEVQRYQGRKTVVFRVVLANPLTSNEILNDVLVEQLELAQESETFLPDLLS
LT
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaataagcgcacagcaaaagcgactcaagagtctttacacagtatttttacc
attccagaagcacctgattcgacattggggctgatcgaaaaagaaatatcagaaaatctt
gctggttttttaggtaatcatattgctgctaaagaacgtgccttaagcgaaattgaaaaa
gatttcgctagctcggctattcccgaagaacctagttttgtctctgatcatactcgccat
attttagataaagttgttgcacaatcagtgcatacatcaagcccaagttttattggtcat
atgacctcagctttaccttactttattttaccgctttctaaattgatggtgggtttaaat
caaaatttagtcaaaattgagacatcaaaagcatttaccccacttgaacgtcaagtgcta
ggtatgatgcatcgtttggtttataaagataatgaccatttttatgagcaatggatgcac
agtgctaaccattcattaggtgccttctgttctggtggcactgtcgccaatttaacggcc
ttttgggtagcgcgtaataatttgttgaaagctgatggtgatttcaaaggtattgcacga
gaaggcttatttaacgcattaaaacattataaatatgatggcttagtgattttagtgtct
gaccgtggccattattcattaaagaagtctgctgatatcctagggattggtcaggacagc
gtgatatcaattcctaccgatggccataaccgcattgattgccagaaattacgtgaaaaa
tgccttgagttgaaacaaagaaacatccgcgtattaagtattgttggcgttgctggtacg
acagaaacaggtaacattgatccattagataaaatggctgatattgctgaagagtttcaa
acacactttcatgtcgatgcagcatggggtggcgcgacattattatcaaataaataccgt
ccactgcttaagggaattgaacgcgctgattcagtaactatcgatgctcacaagcaaatg
tatgtgcccatgggcgcaggccttgtggtgtttaaaaatccggcttctgtggcttctatt
gaacaccatgccgaatatattttacgtaaaggttcaaaagatttaggctctcataccttg
gagggatcaagacccggtatggcgatgttggtttatgcaagcttacatattatcagtcga
cctggttatgaaatgttgattaaccaaggaattgacagagcacggtattttgcagaacgc
attaatcagcatgctgactttgagttaataactgaaccagagttatgtttattaacctat
cgctacaatccaaaagcggttcaaaacttattagcaaatagttcagcagaacaacaagat
aagattaatgatttactcgatgacctgactaaatttattcaaaaacgtcaacgtgaaaat
ggtaaatcatttgtttcacgtacgcgtattgaagtgcagcgttatcaaggtcgaaaaacg
gtggtttttcgtgttgtattggcgaatccattaacctccaatgaaattcttaatgatgtg
ctagtggagcaacttgaattggctcaagaaagtgaaacctttctacctgatttattgtct
ttaacttag

DBGET integrated database retrieval system