KEGG   Colwellia sp. PAMC 20917: A3Q34_12450Help
Entry
A3Q34_12450       CDS       T04511                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
coz  Colwellia sp. PAMC 20917
Pathway
coz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
coz01100  Metabolic pathways
coz01110  Biosynthesis of secondary metabolites
coz01130  Biosynthesis of antibiotics
coz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:coz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A3Q34_12450 (aroK)
Enzymes [BR:coz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     A3Q34_12450 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin AAA_24 AAA_16 AAA_22 AAA_28 dNK AAA APS_kinase AAA_25 ABC_tran AAA_5 TsaE Ploopntkinase3 AAA_29 His_biosynth AAA_17 AAA_7 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AOW77592
UniProt: A0A1D8RWV5
LinkDB All DBs
Position
2887528..2888046
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRELADRLHLEFFDSDQEIERRTGADIAWVFDLEGEEGFR
KREEGVIEDLSEKQGIVLATGGGSVISTQVRNRLSARGIVVYLETTIDKQVARTQRDRKR
PLLQTSEEPRTVLENLAIERNPLYEEIADVIVKTDDQSAKVVAHKIVERLDF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacgtaatattttccttatcggccctatgggcgctggtaaaagcacaatt
ggtagagaattagctgataggctacatcttgagttttttgactctgatcaggaaatagag
cgccgaacaggtgcagacatcgcatgggtttttgatcttgaaggcgaagaaggctttcgc
aaaagagaagaaggtgtaattgaagacttaagtgaaaaacaaggtattgttttagcgact
ggtggtggttcagtgataagtacacaagtacgtaatcgcttatcggcacgaggcatagtt
gtctatttagaaacaactatcgacaagcaagtggctcgtacgcagcgtgatcgtaaacgt
ccattgttgcaaacctctgaagaaccacgcacagtacttgaaaatctagcaatagaacgc
aatcctttatatgaagaaattgctgacgttattgtaaaaacagatgatcaaagtgctaaa
gttgttgcccataaaattgttgagcgcttagatttctaa

DBGET integrated database retrieval system