KEGG   Colwellia sp. PAMC 20917: A3Q34_17200Help
Entry
A3Q34_17200       CDS       T04511                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
coz  Colwellia sp. PAMC 20917
Brite
Enzymes [BR:coz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A3Q34_17200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOW78425
UniProt: A0A1D8RZ87
LinkDB All DBs
Position
complement(4016995..4017576)
Genome map
AA seq 193 aa AA seqDB search
MAIELPALPYAQDALVPHISAETLEFHYGKHHNTYVVKLNGLIEGTDFEGKSLEDIVKTS
SAGIFNNAAQIWNHTFYWNSLSPNGGGEPTGALADAINASFGSFAEFKTKFTESAINNFG
SSWTWLVKKADGSLAIVNTSNAATPLTDESVTPLLTVDLWEHAYYIDYRNLRPSYMAGFW
ALANWDFAAANFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaattacccgcattaccctatgcacaagatgcacttgtaccacatatttca
gctgaaacacttgagtttcactacggtaagcatcacaacacttatgttgtaaagcttaat
ggattaattgaaggtactgattttgaaggcaagtctttagaagacatcgtaaagacttca
tcagcaggcattttcaataatgcagcacaaatttggaatcacacattctactggaacagc
ctaagccctaacggcggcggtgaaccaacaggcgctttggctgatgcgatcaatgcaagc
tttggttctttcgctgaatttaaaacaaaatttactgaaagtgcaatcaacaactttggt
tcaagctggacatggttagtgaaaaaagcagatggtagccttgctatcgttaacacttca
aatgctgcaacaccattaactgatgagagcgttacaccgttattaacagtagatttatgg
gaacatgcttactacattgattaccgtaatcttcgtccaagctacatggctggtttttgg
gcattagctaactgggattttgctgcggcaaacttcgcttaa

DBGET integrated database retrieval system