KEGG   Chlamydia pneumoniae AR39: CP_0814Help
Entry
CP_0814           CDS       T00029                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
cpa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpa01100  Metabolic pathways
cpa01110  Biosynthesis of secondary metabolites
cpa01130  Biosynthesis of antibiotics
cpa01230  Biosynthesis of amino acids
Module
cpa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cpa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CP_0814
Enzymes [BR:cpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CP_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 KTI12 CPT AAA_33 Cytidylate_kin2 dNK 6PF2K AAA Hydin_ADK AAA_17 AAA_15
Motif
Other DBs
NCBI-ProteinID: AAF38610
UniProt: Q9Z6M1
LinkDB All DBs
Position
878691..879221
Genome map
AA seq 176 aa AA seqDB search
MTIILCGLPTSGKSSLGKALAKFLNLPFYDLDDLIVSNYSSALYSSSAEIYKAYGDQKFS
ECEARILETLPPEDALISLGGGTLMYEASYRAIQTRGALVFLSVELPLIYERLEKRGLPE
RLKEAMKTKPLSEILTERIDRMKEIADYIFPVDHVDHSSKSSLEQASQDLITLLKS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgacaattattctatgtggtctacccacaagcggaaagtcttcgctcgggaaagctttg
gctaaatttctaaaccttcctttttatgatcttgatgatttaattgtaagcaactacagc
agtgcactatactcctcatctgcagagatctataaagcttatggggatcagaaattcagt
gaatgtgaagctcgtattcttgaaactttacctccagaagatgccttgatctcccttggt
ggagggaccttgatgtatgaagcctcttaccgagcgattcaaactaggggagctcttgta
tttctctctgtagaactacctttaatttatgaaagactcgagaaacgagggttaccagaa
cggctgaaagaagccatgaaaacaaaacctctaagcgagattttaactgagcgcatcgac
agaatgaaagaaattgctgattacatttttcccgtggatcacgtagatcattcctcgaag
agctccttagaacaagcgtctcaagatctcattaccttgttaaagtcatga

DBGET integrated database retrieval system