KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CPAST_c28880Help
Entry
CPAST_c28880      CDS       T03811                                 

Gene name
gatC3
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit C 1
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cpae  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
cpae00970  Aminoacyl-tRNA biosynthesis
cpae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpae00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CPAST_c28880 (gatC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cpae03029]
    CPAST_c28880 (gatC3)
Enzymes [BR:cpae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CPAST_c28880 (gatC3)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CPAST_c28880 (gatC3)
Mitochondrial biogenesis [BR:cpae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CPAST_c28880 (gatC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln VGPC1_C
Motif
Other DBs
NCBI-ProteinID: AJA48954
UniProt: A0A0H3J662
LinkDB All DBs
Position
3095623..3095910
Genome map
AA seq 95 aa AA seqDB search
MSVSKKDVEYVSELSRLSFSEEEKENLIGDLNSVLGYVEKLNELDTDDVEIIVNPYYIEN
KFREDEIEPSMELSSLLSNAPDKLEEYVVVPKIIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtttcaaaaaaagatgttgaatatgtttcagaactatcaagattaagtttttct
gaagaagaaaaagaaaacctaattggagatttaaatagtgtacttgggtatgtggaaaaa
ttaaatgaattagacacagatgatgtggaaatcatagtaaatccatattatattgaaaat
aaatttagggaagatgagatagaaccttctatggagcttagttcattgttaagtaacgca
ccagataaattagaagaatatgtagttgttcctaaaataatagaatag

DBGET integrated database retrieval system