KEGG   Carica papaya (papaya): 110806347Help
Entry
110806347         CDS       T05151                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00564  Glycerophospholipid metabolism
cpap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110806347
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     110806347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C
Motif
Other DBs
NCBI-GeneID: 110806347
NCBI-ProteinID: XP_021886857
LinkDB All DBs
Position
Unknown
AA seq 395 aa AA seqDB search
HALEERKQVIENAPHLCHALPCMTPCFDWFEVVYYWMGLKLYDLVAGSHLLHLSRYYSAQ
ESVELFPTLARRGKDRSLKGTVVYYDGQMNDSRLNVGLACTAALAGATVLNHAEVVSFLK
DEVTQRVTGARIRDNITGQEFDTYAKVIVNAAGPFCDSVRKMAEKDAKPIICPSSGVHIV
LPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSNTTITLLPEPHEDEIQFILDA
ISDYLNVKVSSCKLRTVLLLTKVSFSMAEDAVNAAIKSGQLSPISGCLTHKLQLVGADGW
EPSSFTVLAQQYMRMKKAHGGKVVPGAMDTAAAKHLSHAYGTMAERVATIAQVRFILHFL
HKVFFLVICYCIIIYWLQQFWISRKFYALNSMFAF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
catgcactggaggagcgtaaacaggttattgagaatgcaccacatttgtgccatgcattg
ccatgcatgacaccttgttttgactggtttgaggtggtgtactactggatgggtttgaaa
ttgtacgacttggttgcaggatcacacttgttacatttgtccagatattattctgcacag
gaatctgttgagctcttccctactcttgcaaggaggggtaaggacaggagcttgaagggt
actgttgtgtattatgatggccagatgaatgactcacgacttaatgttgggttggcatgt
actgctgcattagctggtgcaacagtgttgaaccatgcagaagttgtttcctttctaaag
gatgaggtaactcagcgggtcactggtgcacgcattcgggacaatataacaggccaagaa
tttgatacctatgcaaaggtaattgtaaatgcggctggcccattttgtgactctgtgagg
aaaatggccgagaaagatgcaaaacctattatttgtccaagtagcggagtgcacattgtt
ctccctgattactattctcctgaagggatgggtcttattgttcccaaaactaaggatggt
cgcgttgttttcatgctgccttggttgggaagaactgtagctgggactacagattccaac
acgacaatcactttgctccctgaaccgcatgaggatgagattcagtttatactggatgct
atcagtgattaccttaatgttaaggtaagtagttgcaaactaaggaccgttttgctcctt
accaaagttagtttcagcatggcagaggatgcagtcaatgcagccatcaagtctggacag
ttgagtccaatcagtggctgtttaactcataaactgcaacttgttggcgctgacggatgg
gagccctcctcttttacagttcttgctcagcaatacatgcgcatgaaaaaagcccatggt
ggtaaagtagtccctggggcaatggacacagctgcagcaaagcatttatctcatgcatat
ggtacaatggcagaacgagtggctaccatagcccaggtcaggtttatcttgcattttctt
cacaaagttttctttttggtaatctgctattgtataattatttattggctccaacagttt
tggatttcaagaaaattctatgcattaaattccatgtttgcattctga

DBGET integrated database retrieval system