KEGG   Carica papaya (papaya): 110807478Help
Entry
110807478         CDS       T05151                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap03030  DNA replication
cpap03410  Base excision repair
cpap03420  Nucleotide excision repair
cpap03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110807478
   03410 Base excision repair
    110807478
   03420 Nucleotide excision repair
    110807478
   03430 Mismatch repair
    110807478
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cpap03032]
    110807478
   03400 DNA repair and recombination proteins [BR:cpap03400]
    110807478
Enzymes [BR:cpap01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110807478
    6.5.1.6  DNA ligase (ATP or NAD+)
     110807478
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110807478
DNA replication proteins [BR:cpap03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110807478
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110807478
DNA repair and recombination proteins [BR:cpap03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110807478
   NER (nucleotide excision repair)
    Other NER factors
     110807478
   MMR (mismatch excision repair)
    Other MMR factors
     110807478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 110807478
NCBI-ProteinID: XP_021888311
LinkDB All DBs
Position
Unknown
AA seq 1460 aa AA seqDB search
MASSPPTATPNGKTLTLDSCRLYVTALNPLSSHTSTPDPSLSFHPIPSTFPLSKLIPNTR
FLVDAFRFPSSSNFSASFFLSHFHSDHYAGLSASWSKGIIFCSHITSRLLIDVLQVSSPF
IFSLPLQQPVVIDGCEVTLVDANHCPGAVQFLFKVPLKNGGFERYVHTGDFRFSESMKSD
TCLSGFVGCDAIFLDTTYCNPKFVFPLQQESIDYVVSVIDRIGGEFSAMRKRVLFLVATY
VVGKEKILTEVARRCKRKIHVDARKMAVFRVLGYGDGEIFTEDERESDVHVVGWNVLGET
WPYFRPNFVRMKDIMVEKGYEKVVGFVPTGWTYEVKRNKFAVRCKDSYEIHLVPYSEHSN
YDELREYVKYLKPKRVIPTVGMDAENIDSKHAIKMRKHFVGLVDEMANKKDFLMGFYLKS
CEHGEKAEMNASIGLNEPDQEKGSSFEAPTIEKNDPGDTLDDTILSVEPSLRVSTLQVND
EETEKIIGELRNCLPTWVTQEQILDLIGKSGRNIVEVASNFYEHETLFYEQVFACSTSGA
ASQTILLNETVPLLKPASVENSPHKRVGIHLSQVCKSLNIKTSVKSSISPGKRKNIVDNK
PNKKIKSSTKLESSGPKQSTITRFFSKQLPNQFHTDEGGSKTKECVTDEYPVPNDATVQY
KEEIDQFIGILNGNESLRSYAASILQKTKGDINVALDIYYCNPEDNIGENAERLAISIGS
AQVQHFANCSFPLKNVSQHMDNSSKPNSTREHVNTTLVSLPPEKYKPIEHACWRDGEPAP
YIHLARTFDLVEGEKGKIRATSMLCNMFRSLLALSPEDVLPAVYLCTNKIASDHENIELN
IGGSLVTTALEEACGTNRSKLRDMYNDLGDLGDVAQVCRQRQMLLAPPPPLLIREVFSTL
RKISAQTGSQSTSRKKNLIINLMRSCREKEIKFLVRTXXXXXXXXXXXXXXXXXLCFIQV
RNLRIGAMMRTVLPALAQAVVMNLSLNSQLEEKTEDLKEKLQGLSVAVVEAYNILPNLDL
LVPSIIEKGVGFSSTTLSMVPGIPIKPMLAKIANGVPQALKLFQSKAFTCEYKYDGQRAQ
IHKLVDGTVHVFSRNGDETTSRFPDLVDTVNKFSKPAAETFILDAEVVAVDRRNGCKIMS
FQELSSRGRGSRDSLIAVGSIKVCYPPMSYVLCKHLVLQIAKRQCELRGKYFSPFSLGFS
FYEWPSDLHFEVALQLSTKLFDTLEVFFAYLRGSMKIKDHKVEADDACLGNEVSLTRINS
FLEDAFHSSCEGIMVKCLDVDAGYSPSKRTDTWLKVKRDYVEGLSDSLDLVPIGAWHGNG
RKAGWYSPFLMACYNPETEEYQSVCRVMSGFSDSFYAEMKEFYSDDKILSKRPVYYRTAE
VPDMWFPPVLVWEIRGADFTVSPVHQAAIGLVHSSRGISIRFPRFIRSVLDRNPEECSTA
AEIAEMFHSQTRKMDVTAED
NT seq 4383 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctcctcccactgccactcccaacggcaaaaccctaaccctagactcctgc
cgcctctatgtcaccgctctcaaccccctctcttcccatacctctactcccgatccctcc
ctttctttccatcccattccctccactttccctctttccaaactcatccctaacacccgc
ttcctcgtagacgcttttcgcttcccttcctcctctaatttctccgcttctttcttcctc
tctcacttccattccgatcactacgccggcctctctgcctcctggtctaaaggcatcatc
ttctgctcccacataacctcccgcctcctcatcgacgtccttcaagtttcctcacccttc
atcttctccttgcctttacaacagcccgttgtaattgatggctgcgaggttactctcgtt
gatgccaaccattgtccaggagcagtccagttcctattcaaggttcccctgaaaaacggg
ggttttgaaagatatgttcatacaggtgattttaggttttccgagtccatgaaatcggat
acttgtttgagcggctttgttgggtgcgacgcgattttcttggatactacttattgcaat
cccaagtttgtatttcctttgcaacaagagtcgattgactatgtggtcagtgtcatagat
aggataggaggggagtttagtgcgatgaggaagagagttttgtttcttgttgctacttat
gttgtcgggaaagaaaagattttgaccgaggttgcaaggagatgtaaaagaaagattcac
gtggatgcaaggaaaatggcagttttccgcgttttaggatatggggatggtgagatattt
acagaagatgagagggagagtgatgttcatgttgttgggtggaatgtgttgggcgagact
tggccctattttagaccgaattttgtgagaatgaaggatattatggttgagaaaggctat
gaaaaggttgttggttttgtgccaactgggtggacttatgaagtgaagcgcaataagttt
gcagtcaggtgcaaggattcttatgagattcatcttgtaccatatagtgagcattcgaat
tatgatgaactaagagagtatgtgaaatatttgaaaccaaagagggtgatccctactgtt
ggtatggatgctgagaatattgatagcaagcatgcgattaaaatgcgaaaacattttgta
gggcttgtcgatgaaatggctaataagaaagacttcttaatgggtttctatctcaaatca
tgtgaacatggtgaaaaggctgaaatgaatgctagcattggcctgaatgagccagaccaa
gagaaggggagctcatttgaagcaccaaccattgagaagaatgatcctggtgatactttg
gatgatacaattttatcagtggaaccttctttaagagtttccactttacaagtaaatgat
gaggaaaccgaaaaaatcattggggaacttcgtaattgtttgcccacgtgggtcacccaa
gagcagatacttgatttaattgggaagtcgggaagaaatattgttgaagttgcctctaat
ttctatgaacacgaaactttgttttatgagcaagtctttgcttgttcaacttctggtgct
gcatcacaaaccattttgctaaacgagactgtgccgcttctaaaaccagcttctgttgag
aatagtcctcataaaagggtaggcattcatctaagtcaagtatgcaagtccctaaacatt
aaaacttccgtgaaaagcagcatttcacctggaaaaagaaagaatattgttgacaataag
ccaaacaaaaaaataaaatctagtactaaactggaatcttccgggcctaagcaatctacg
ataaccaggttcttcagtaaacaattgcctaatcaatttcacacggatgaaggtggctct
aagaccaaggaatgcgttacagatgagtatccagtcccaaatgatgctacagtacagtac
aaagaagagatagatcaatttattgggatattaaatggcaatgaatcattgagaagctat
gctgctagtatcctgcaaaagactaaaggagacattaatgtagcccttgatatatattat
tgtaatccagaggataacattggtgaaaatgctgaaagattggctatctctattggctcg
gctcaggttcagcattttgctaactgctcatttcccctgaagaatgtctcacaacatatg
gataattcatccaagcctaactccacaagagaacatgtaaatactactctggtgtcacta
cctccggagaaatacaaacctattgagcacgcatgctggagggatggagaacctgctcca
tatatccatcttgcacgaacttttgacctggttgagggtgaaaagggcaagattagagct
acttctatgctttgcaacatgtttagaagtttgttggcgttgtcccctgaagatgtgctg
cctgctgtgtatctgtgtacaaataagattgcttctgaccacgaaaatattgaactaaat
attggtggaagtttagttacgacagctttggaggaggcttgtgggacaaaccgatctaaa
ttaagggatatgtacaatgacttgggtgaccttggggatgttgctcaagtatgccgacaa
agacagatgttacttgctcctcctcccccacttctaattcgagaggtattttctacactc
cgaaagataagtgcacaaacaggtagtcaaagtaccagccggaagaaaaaccttataatt
aatctcatgcgttcttgtagagaaaaggagattaagtttcttgttaggacctnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnctgtgctttattcaggtc
cggaatttgagaattggagcaatgatgagaacggttctgcctgcactggctcaagctgtt
gttatgaatttgtctcttaattcccaacttgaagaaaaaacagaagatttaaaagaaaag
cttcagggcctttctgttgcagtagttgaagcatataatatacttcctaatttggatctt
cttgttccttctataattgaaaaaggcgttggattttcctcaacaactttgtcaatggtt
ccgggaatacctattaaaccaatgctagcaaaaattgctaatggggttccacaagctcta
aagctctttcaaagcaaagcttttacatgtgaatataaatatgatggtcagcgtgcccag
atccataaattagtggatggtactgtacatgtattttctcgcaatggggatgaaacgacg
tcaagatttccagatttagttgatacagttaacaaattttctaagcctgctgctgagaca
ttcatattggatgcagaggtggttgcagtcgataggagaaatggatgcaagatcatgtcc
ttccaagaactgtcttccagagggagagggagcagagattccttgatcgcggttggtagt
ataaaggtatgctatcctcccatgtcatatgttttgtgcaagcacctagtgttacaaata
gctaaaagacaatgtgaactacgggggaaatatttctccccattctcacttgggttttca
ttttacgaatggccatctgatttgcattttgaggtggctttgcaactttcgactaagtta
tttgacactcttgaggttttctttgcctatttgaggggttctatgaagattaaagatcat
aaagtggaagcagatgatgcttgtttaggtaacgaagtcagcttgactaggataaactct
tttcttgaagatgcattccattcctcatgtgaaggaattatggttaagtgtttagatgtt
gatgctggatattctccatcaaagcgtactgacacatggttaaaggtcaagcgagattat
gttgaaggactgagtgactcgctggatttagtcccaattggggcttggcatggaaatgga
agaaaagcaggatggtacagtccattcctcatggcatgttacaacccggagactgaggaa
taccaaagtgtctgccgtgtcatgtctggcttctcagattctttttatgcagagatgaag
gaattctactctgatgataagatcttatccaaaaggccagtttattatagaacagcggag
gtgccagacatgtggtttcctccagtacttgtttgggaaatccgaggtgcagacttcaca
gtgtcacccgttcaccaagctgccataggtttagttcactcttcccgtggcatttcaata
agatttcctagatttattcggtctgtgttggatagaaaccccgaggaatgtagtacagca
gcagaaatagctgaaatgtttcactctcagactcgtaagatggatgtgacagccgaagat
tga

DBGET integrated database retrieval system