KEGG   Carica papaya (papaya): 110811911Help
Entry
110811911         CDS       T05151                                 

Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00010  Glycolysis / Gluconeogenesis
cpap00051  Fructose and mannose metabolism
cpap00052  Galactose metabolism
cpap00500  Starch and sucrose metabolism
cpap00520  Amino sugar and nucleotide sugar metabolism
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
cpap01200  Carbon metabolism
Module
cpap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cpap_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110811911
   00051 Fructose and mannose metabolism
    110811911
   00052 Galactose metabolism
    110811911
   00500 Starch and sucrose metabolism
    110811911
   00520 Amino sugar and nucleotide sugar metabolism
    110811911
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110811911
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpap04131]
    110811911
Enzymes [BR:cpap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110811911
Membrane trafficking [BR:cpap04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110811911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110811911
NCBI-ProteinID: XP_021894233
LinkDB All DBs
Position
Unknown
AA seq 507 aa AA seqDB search
MGKLALGVAVGVAVAACSVAAVVVGRRVRSRRKWKRVVGVLRELEEACETPVARLRQIVD
AMAVEMHAGLASEGGSKLRMLLTFVDKLPNGSERGTYYALDLGGTNFRVLRVKLGGQRSS
ILAQDVDTKPIPEHLMTGTSEELFDFLASSLQQFVEAEGNGSEPSHVRRRQLGFTFSFPV
KQTSISSGILLKWTKGFAIEETVGKDVAECLQQALDRKGVDMQIAVLVNDTVGTLALGHY
HDEDTVAAVIIGTGSNACYLERTDAIIKCQGLLTSSGFMVVNMEWGNFWSSHLPRTSYDI
DLDAESPNPNDMGFEKMVSGMYLGELVRRVILRMAEESEIFGPVSSKLLMPFVLRTPSMA
AMHEDDSSDLSVVAKILKDILEMPDVPLKARKLVVKLCDVVTRRAARLAAAGVAGILKKV
GRDGSGGITAGRSRSDTKMRRTVVAIEGGLYKSYKVFREYLHEALIEILGEDVAQHISLK
ATRDGSGIGAALLAASRSAYTVDKVQI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggggaagttggcgttgggtgtggcggtgggagtcgcggtggcggcctgttctgtggcg
gcagtggtggtgggaagaagggtgaggagcaggaggaagtggaagagggtggttggggtg
ttgagggaattggaggaggcatgtgagacccctgtggcgcggctaaggcagattgttgac
gcgatggcggtggagatgcatgctggtttggcatctgaaggagggtccaagctcagaatg
ttgctcacttttgttgataaactaccaaacgggagtgagagaggaacttattatgctcta
gatcttgggggtacaaattttagggtgttacgggttaagctaggaggtcaaaggtcctct
atcttggctcaagatgtggacacaaaacctattcccgaacatttgatgactggcacaagt
gaggagctctttgattttttagcttcatcactacagcagtttgtcgaagcagaaggaaat
ggttctgagccttctcatgttagaagaaggcaacttggatttacattctcctttccagtg
aaacaaacatctatttcatctgggattttattgaaatggacgaaagggtttgcaattgaa
gaaactgttggaaaagatgttgctgaatgtctgcagcaggcattggacaggaaaggcgta
gatatgcaaattgcagtgttagttaatgatacagtaggaacactagctcttggacattat
catgatgaagacacagttgccgcagtgattattggaactggtagtaatgcctgctatttg
gagagaacagatgcaattattaagtgtcaaggactacttacttcatctggattcatggtt
gtcaacatggaatggggaaatttttggtcatctcatctgccaagaacatcatatgacatt
gatttagatgcagaaagtcctaatcctaatgatatggggtttgaaaaaatggtatctgga
atgtatttgggtgaacttgtcaggagagtgattcttaggatggcagaagagtcagaaatc
tttggacctgtttcatccaagttattaatgccttttgttttgaggacaccttcaatggct
gccatgcatgaggatgattcctctgatttatcagtcgtcgcaaaaatcttaaaagatatt
ttagagatgccagatgtccccttaaaggccaggaaactggttgttaagttatgtgatgtg
gttactcgaagggctgccagattggctgctgccggagttgcaggaatcttgaagaaggta
ggccgggatggtagtggtggcattacggccggaagaagtaggagtgatacaaagatgaga
agaacggttgtcgcgattgaggggggtttgtataagagttacaaagtattccgggaatac
ttgcatgaagccttgattgaaatcttaggggaagatgttgcacaacatatcagtctaaag
gcaacacgagatggatcaggcattggtgcggcactgcttgctgcctcacgttcagcttat
actgtggataaggtacagatataa

DBGET integrated database retrieval system