KEGG   Carica papaya (papaya): 110813323Help
Entry
110813323         CDS       T05151                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00010  Glycolysis / Gluconeogenesis
cpap00020  Citrate cycle (TCA cycle)
cpap00620  Pyruvate metabolism
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
cpap01200  Carbon metabolism
Module
cpap_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110813323
   00020 Citrate cycle (TCA cycle)
    110813323
   00620 Pyruvate metabolism
    110813323
Enzymes [BR:cpap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110813323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Redoxin
Motif
Other DBs
NCBI-GeneID: 110813323
NCBI-ProteinID: XP_021896098
LinkDB All DBs
Position
Unknown
AA seq 474 aa AA seqDB search
MSHLLQTSFLPSSPSLRRNPNASVPQFHIPGHRGRTSACPIRAKIREIFMPALSSTMTEG
KIVSWIKSEGDKLSKGESVVVVESDKADMDVETFHDGFLAAIMVEEGGVAPVGSAIALLA
ETEDEIALARSKANTNNSTSTASAPDPAVVTVSSATTTVTKEEKFVGPKTPVAVAASAVH
PASEGGKRIVASPYAKKLAKELKMELAGIVGSGPMGRIVAKDVEAAAVAAAEVVPAAALN
TATTAAAPGIELGTVVPFTTMQAAVSRNMVESLAVPTFRIGCTITTDALDALYKKIKSKG
VTMTALLAKATALALVKHHVVNSSCRDGNSFTYNSSINIAVAVAMDGGLITPVLQDADKV
DIYSLSRKWKELVDKARAKQLQPHEYNTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGA
SQPTVVASKDGRIGMKNQMQVNVTADHRVIYGADLAQFLQTLAKIIEDPKDLTF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaccttctccaaacttcatttctgccctcctctccctctttacggaggaaccct
aacgcctccgtgccgcaattccacattccaggtcaccggggcaggacgtcagcatgtcca
attcgggccaagatccgggagatctttatgccggcgcttagctccaccatgacagagggt
aagatcgtctcctggatcaagtcggagggcgacaaactctcgaagggcgagagtgtggtg
gttgtcgagtccgacaaggctgacatggacgttgagaccttccacgacgggtttcttgcc
gccatcatggtggaggaaggtggcgttgcccccgtcggatccgccattgcactcttggcc
gagactgaagatgagatcgccctcgcgagatcgaaggccaacactaacaattccacttcc
acagcttctgcacccgatcctgctgttgtcactgtctcttctgctacaacaactgttact
aaagaggagaaatttgtcggacccaaaactccagtggcagtggcggcatccgctgtgcac
cctgcatccgaaggagggaagaggatagtggcgtcaccatacgcaaagaagctggctaag
gagttgaaaatggagcttgcgggtatagttgggagtgggcccatgggaaggattgtggct
aaggatgttgaggcggccgctgttgcggcagctgaagtggtgccggcggcggcgctgaac
acagcaactacggcggctgcaccgggaattgaattggggacagttgtgcccttcaccaca
atgcaggcggctgtgagcagaaatatggtagagagtttggctgtcccgacttttagaatt
gggtgcactattacaacggatgcgctcgatgccctatacaaaaagatcaagtccaagggg
gtaacaatgacggcattactcgcaaaggcaacggcgcttgcactagttaaacatcatgtt
gtaaactcttcctgcagagatggtaacagttttacatataacagtagcatcaacatcgcg
gttgctgtggcaatggatggtggactaattacaccagtgcttcaggatgctgataaggtt
gatatatattcattgtcaagaaaatggaaagagttagttgacaaggccagagcaaagcag
ctgcaacctcatgagtacaatacaggaacattcactctttctaaccttgggatgtttggt
gtggaccgatttgatgccattttgccacctggaaccggagcaattatggctgttggagca
tctcagcctactgtagttgctagcaaggatggccggattggcatgaagaaccagatgcag
gtaaacgttacagcagatcatcgtgtcatctatggcgctgatcttgctcagttcttgcaa
accttggcgaagattattgaggaccccaaagatctcacattctaa

DBGET integrated database retrieval system