KEGG   Carica papaya (papaya): 110814687Help
Entry
110814687         CDS       T05151                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00620  Pyruvate metabolism
cpap00710  Carbon fixation in photosynthetic organisms
cpap01100  Metabolic pathways
cpap01200  Carbon metabolism
Module
cpap_M00168  CAM (Crassulacean acid metabolism), dark
cpap_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cpap_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cpap_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    110814687
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110814687
Enzymes [BR:cpap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     110814687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 110814687
NCBI-ProteinID: XP_021897927
LinkDB All DBs
Position
Unknown
AA seq 964 aa AA seqDB search
MPTRNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQEC
YEFSAEYEGKHDPQKLEELGNVLTSLDPGDSIVITKSFSHMLSLANLAEEVQIAYRRRIK
LKKGDFADENSATTESDIEETFKRLLQLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRSL
LQKHARIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTQPAPQDEMRAGMX
YFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAANMYFSQIEDLMFELSMWRCNDELRARADELHRSSRRDAKHYIEFWKQIPP
NEPYRVILGDVRDKLYNTRERSRQLLANGISEIPEDATFTNVEQFLEPLELCYGSLCSCG
DRSIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAVTRHLGIGSYREWSEEKRQ
EWLLSELSGKRPLFGPDLPKTEEITDVLDTFHVIAELPADNFGAYIISMATAPSDVLLVE
LLQRECRVKHPLRVVPLFERLADLEAAPAAVARLFSIDWYQNRINGKQEVMIGYSDSGKD
AGRLSAAWQLYKAQEELVKVAKQYGIKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVIATKE
YRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGAAFKYIIEKDVKNLHMLQEMYNQWPFFRVTIDLVEMVFAKGDPGIAALYDKL
LVSEELWSFGEHLRNNYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDAYITTLNVCQAY
TLKQIRDPNFHVKVRPHLSKDYMESSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgccgactaggaatttggagaagatggcatcgatagatgctcagttgagactactggca
ccgaggaaggtctctgaggatgataagctggtggagtatgatgctttgctattggatcgg
tttcttgatattcttcaagatttacatggagaggagattagagaaacggttcaagaatgt
tacgagttttcagctgagtatgaagggaagcatgaccctcagaaattagaggagcttggg
aatgtgctgacaagtttggatcctggagattcaatagttattacaaaatcattttcccac
atgcttagcttggccaatttggctgaagaagttcaaattgcttatcggcgaaggatcaaa
cttaagaagggtgattttgctgatgagaattctgcaacaactgaatcagacattgaagaa
accttcaagaggcttttgcaattgaagaagtcacctgaagaagtgtttgatgctttgaaa
aaccagactgttgacttggtcttgactgcacatcctactcaatctgtccgtagatctttg
cttcagaagcatgcaaggatccgcaattgcttgacccaattatatgcgaaggatatcact
cctgatgataagcaggaacttgatgaggctttacaaagagagattcaagctgcatttcgt
acagatgagatcagaagaactcagccagctccacaagatgaaatgagagcaggaatgnag
tatttccatgaaacaatttggaaaggcgtgccaaaatttttgcggcgtgttgacactgct
ttgaagaacataggaataaatgaacgtgttccttacaatgccccgctcattcagttttct
tcttggatgggtggagatcgtgatggaaatccccgggtaactcctgaagtaaccagagat
gtatgcttactggccagaatgatggctgctaacatgtacttctcccaaatagaagacctt
atgtttgagttgtcaatgtggcgctgcaatgatgaactacgtgctcgtgcagatgaactt
cataggtcctcaaggagggatgcaaaacattatatagaattttggaaacaaattcctccc
aatgaaccctaccgtgttattcttggtgatgtgagggataagctgtacaatacacgtgaa
cgttctcgtcagttactagccaatgggatttctgagattcccgaggatgcaacttttaca
aatgttgagcagtttctggagcctcttgaactctgttatgggtcactctgctcttgcggt
gataggtcaatagctgatggaagccttcttgattttttacgtcaagtgtctacctttggg
ctttcacttgttagacttgatatccggcaagaatctgacagacacactgatgttatcgat
gcagtcactagacacttgggaattggatcttatcgtgaatggtctgaagagaagagacaa
gaatggctcttatctgagctcagtggcaaacgccccctttttggtcctgatcttcccaaa
actgaagaaataactgatgtattagacacatttcatgtcattgctgagcttcctgcagat
aattttggtgcctatataatctcaatggcaacagccccatctgatgtactacttgttgag
cttttacaacgtgaatgtcgagtgaagcatccacttagagttgttccattgtttgagaga
cttgctgatcttgaagctgctcctgcagctgtggcccgtctcttctctattgattggtac
caaaatcggatcaatgggaagcaagaagtcatgatagggtattcagattcgggaaaagat
gctggtcgtctctctgctgcttggcagttatacaaagctcaggaagagcttgtaaaggtg
gcaaagcagtatggcattaagcttacaatgttccatggccgaggtggaacagtgggaaga
ggaggtgggccgactcaccttgctatattgtctcaaccccctgacacaattcatggatca
cttcgagttacagttcaaggtgaagttattgaacaatcctttggagaggaacatttgtgc
ttcagaacactacagcggtttacagctgctactcttgaacacggtatgcaccctccagtc
tccccaaagccagaatggcgtgcactcatggatgagatggcagtcattgcaacaaaagaa
taccgttctatagttttccaggaacctcgttttgtcgagtactttcgcctggcaacccca
gagttggagtatggtcggatgaacatagggagtcgtccatcaaaacgaaagccaagtggc
ggaattgaatcactccgtgcaatcccatggatctttgcatggacgcagacgagattccat
ctacctgtgtggcttggctttggagctgcatttaagtatatcattgagaaagatgttaag
aatcttcacatgctccaggagatgtacaatcagtggcctttttttagggttacaattgac
ttagttgagatggtgttcgccaagggagacccaggaattgctgctttatacgataaactc
cttgtgtcagaagagttatggtcgtttggtgagcatttgaggaataactatgaagaaaca
aagagccttctcctccagattgctgggcataaagatctcctcgaaggagatccctacttg
aagcaaaggcttcgtcttcgtgatgcatacattacaacactcaacgtatgccaagcatat
actctgaagcagatccgtgatcccaacttccatgttaaggtgaggccacatttgtcgaaa
gattatatggaatcaagcaagcctgcggcagagcttgtgaagcttaaccccacaagtgaa
tatgcacctggccttgaggacacccttattttgacaatgaagggtattgcagcgggcatg
cagaacactggttga

DBGET integrated database retrieval system