KEGG   Carica papaya (papaya): 110815217Help
Entry
110815217         CDS       T05151                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00500  Starch and sucrose metabolism
cpap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110815217
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     110815217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 110815217
NCBI-ProteinID: XP_021898585
LinkDB All DBs
Position
Unknown
AA seq 419 aa AA seqDB search
MTPLLSLSLFLVAFPAFTSPTLLFQGFNWESWKKPGGWYNSLKNSIPDIANAGITHVWLP
PPSHSVSPQGYMPGRLYDLSASKYGSPEELRSLIQSFHEKGIKCLADIVINHRTAEKRDG
RGIYSIFEGGTSDDRLDWGPSFICRNDEYSDGTGNPDTGEDFPPAPDIDHLNLRVQNELS
DWMNWLKTELGYDGWRFDFVKGYTPSITKLYMERTSPGFAVGEKWDSLSYGEDGKPNVNQ
DSHRGRLKDWVEVAGGVVTAFDFTTKGILQEAVKDELWRLKDSNGNPPGLIGILPERAVT
FIDNHDTGSTQNHWPFPSDKIMQGYAYILTHPGIPSIFYDHFIDWNLKDEITKLADIRNR
NVIGAGSRVNILASESGLYVAAIDDKIIMKIGPKMDLGNLIPSDFLLATSGQDYAVWEK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgactcctctcctctctctctctctcttccttgtcgctttccctgctttcacttctcct
accttgttatttcagggattcaattgggaatcatggaaaaaaccaggaggatggtacaac
tcactcaagaactctatccctgatattgctaatgctggaatcactcatgtctggcttcct
cctccatctcactctgtttcaccccaagggtacatgcctggaagattatacgatttgagt
gcatcaaaatatggatctccggaagagttgaggtctctgatacaatctttccatgagaaa
ggaataaagtgcttagccgacatcgtaatcaaccatagaacagcagaaaagcgagatggt
agaggaatatacagcatttttgaaggtggaacgtccgatgatcgtctggactggggacca
tctttcatttgccggaacgatgaatattccgatggtacgggtaatcccgacaccggagaa
gatttcccgccagctcccgacattgatcatctaaatctcagagtacaaaacgagttatca
gactggatgaactggttgaaaactgaattgggatatgatggatggagatttgatttcgta
aaaggttatactccgagtattaccaaactttacatggagagaacttcaccgggcttcgca
gtgggagagaaatgggattctctctcgtacggagaggatggaaaacccaacgtcaatcag
gatagtcatcggggaagattaaaagattgggttgaggttgcgggtggagtggtaacggca
tttgattttacaacaaaagggattctgcaagaagctgtgaaagatgagctatggcgattg
aaggattcaaatggaaacccaccaggactgattggtatcttaccagaaagagcagtgact
ttcatcgacaatcatgatacaggatcaactcagaaccattggccattcccatctgataaa
atcatgcaaggatacgcttatatcctaacccatccgggcatcccatccattttctacgat
cacttcattgattggaatctgaaggatgagataacaaaattggcagatatcaggaatcgg
aacgtgatcggcgccggaagcagagtaaatattttagcttcagagagtgggttgtacgta
gcagccattgatgacaagatcattatgaagattggaccaaaaatggacctgggaaacctc
attccttcagatttcctccttgctacctccggacaagactatgccgtttgggagaaatga

DBGET integrated database retrieval system