KEGG   Carica papaya (papaya): 110815249Help
Entry
110815249         CDS       T05151                                 

Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00330  Arginine and proline metabolism
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
cpap01230  Biosynthesis of amino acids
Module
cpap_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110815249
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     110815249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 NAD_Gly3P_dh_N PDH ApbA GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 110815249
NCBI-ProteinID: XP_021898634
LinkDB All DBs
Position
Unknown
AA seq 275 aa AA seqDB search
MEVVPIQVETYKLGFIGAGKMAESIARGVVKSGLLPPQRICTSHSNPNRRIVFESFGVKL
LPNNDAVVEDSDVVIFSVKPQVVKDVVLKLRPLLSKKKLLVSIAAGIKLKDLEEWAGHSR
FIRAIPNTPSAVGEAATVMSLGGAATEDDGELVANLFGSVGKIWRANEKLFDAITGLSGS
GPAYIYLAIEALADGGVAAGLPRELALALASQTVLGAASVATQTGKHPGQLKDDVTSPGG
TTIAGIHELEKGGFRGTLMNAVVAAAKRSRELSQS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaggtagtcccgatacaggtggagacgtacaagctggggttcataggagcagggaaa
atggcagagagcatagcgagaggtgtggtaaaatcaggtttgctgcctccgcaacgtatc
tgcacttctcactcgaatcccaatcgccgcattgtcttcgaatccttcggcgtcaaactc
cttcccaacaacgacgccgttgttgaagacagtgatgtggttattttttcagtaaaaccc
caagttgtgaaagatgtggtcttgaagttgaggccactgctttccaagaagaagcttttg
gtttcaattgctgccggaataaaattgaaggatctagaggaatgggctggtcatagccga
tttataagagcgataccaaatactccttctgctgttggagaggcagcaacagttatgagc
ttgggaggggctgctacagaagatgatggggaactagttgctaatttatttggatcagtt
ggcaagatatggagagctaatgagaaactgtttgatgcaattactggtctcagtggcagc
ggtccggcatatatatatttggcaattgaagctttggctgatggaggtgttgctgcaggt
ctcccacgagaactcgcattggctttagcttctcagactgttctgggagcagcatctgtg
gccactcagacaggaaagcatccaggtcagctcaaagatgatgttacatcgcctggtggg
accacaatcgctggtattcacgagttggagaagggtggatttcgtggaacattgatgaat
gcagtggttgcagcagcaaagcggagccgggagctctcccagagttga

DBGET integrated database retrieval system