KEGG   Carica papaya (papaya): 110816206Help
Entry
110816206         CDS       T05151                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00071  Fatty acid degradation
cpap00592  alpha-Linolenic acid metabolism
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
cpap01212  Fatty acid metabolism
Module
cpap_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110816206
   00592 alpha-Linolenic acid metabolism
    110816206
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     110816206
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     110816206
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110816206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 3HCDH_N Pyr_redox_2 F420_oxidored DAO
Motif
Other DBs
NCBI-GeneID: 110816206
NCBI-ProteinID: XP_021899979
LinkDB All DBs
Position
Unknown
AA seq 301 aa AA seqDB search
MAEVWVTMDVGNDGVAIIAISNPPVNALAIPIIAGLKEKFDDAVRRNDVKAIVLTGKGGK
FSGGFDINVFQKVHETGDVSLMPDVSVELLCNTIEDCQKPVVAAVEGLALGGGLEVAMGC
LARIATPKVLLGLPELTLGVIPGFGGTQRLPRLVGLTKAIEMMLVMISSMVFCLYMTHFS
HGHFIGRRKQRRKTLLKFDFQEAKVFKDLVLLDTSKGLVHAFFSQRATSKVPNITDVGLK
PRRIKKVAVIGGGLMGSGIATALILSNTHVILKEINSEYLLKGVKSIEGAYVDAFIYELC
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtttgggtaaccatggatgtcgggaacgacggcgttgcaataatcgctatc
agtaatcctcctgttaatgcccttgccattccaattatcgctggactgaaggagaagttt
gatgatgcagttaggagaaatgatgttaaggctattgttttgacgggaaaaggagggaag
ttttctggtgggtttgatatcaatgtcttccagaaggttcacgagacgggggacgtgtca
cttatgcctgatgtatctgtggagctcttgtgcaacaccattgaagattgccagaaaccc
gttgttgcggctgtagaaggactagctcttggtggaggcttagaagtagcaatggggtgc
cttgcacgcattgccactccaaaagttctgctagggttgccagaattgacgcttggagtg
ataccagggtttggaggaacacaacgccttccaaggctggtgggactcacaaaggccatc
gagatgatgttggtaatgatctcttccatggttttttgtctatatatgactcatttttcc
catggacattttatagggaggaggaagcagaggagaaaaactcttttgaaatttgacttc
caggaagcaaaagttttcaaggatttggtgttgttagacacttcaaagggtcttgttcat
gcctttttttctcaacgtgccacatcaaaggtgccaaatattactgatgttggactcaaa
ccgaggcgtattaagaaagtagcagttattggtggaggtctaatgggttctggtatagct
acagctcttattctgagcaacacacatgttattctcaaggaaattaactcggaatatctg
ctgaagggggttaaatcaattgaaggtgcttatgttgatgcatttatttatgaactatgt
gcttaa

DBGET integrated database retrieval system