KEGG   Carica papaya (papaya): 110817151Help
Entry
110817151         CDS       T05151                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00220  Arginine biosynthesis
cpap00250  Alanine, aspartate and glutamate metabolism
cpap00260  Glycine, serine and threonine metabolism
cpap00630  Glyoxylate and dicarboxylate metabolism
cpap00710  Carbon fixation in photosynthetic organisms
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
cpap01200  Carbon metabolism
cpap01210  2-Oxocarboxylic acid metabolism
cpap01230  Biosynthesis of amino acids
Module
cpap_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cpap_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110817151
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110817151
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110817151
   00260 Glycine, serine and threonine metabolism
    110817151
   00220 Arginine biosynthesis
    110817151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpap01007]
    110817151
Enzymes [BR:cpap01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     110817151
    2.6.1.4  glycine transaminase
     110817151
    2.6.1.44  alanine---glyoxylate transaminase
     110817151
Amino acid related enzymes [BR:cpap01007]
 Aminotransferase (transaminase)
  Class I
   110817151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 110817151
NCBI-ProteinID: XP_021901266
LinkDB All DBs
Position
Unknown
AA seq 480 aa AA seqDB search
MAPKALDYESLNENVKRVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGLLFPADAIARAKHYLSLTPGGLGAYSDSRGLPGIRKEVAEFI
ERRDGYPSDPELIFLTDGASKGVMQILNAVIRGQGDGVLVPVPQYPLYSATISLLGGSLV
PYYLEETANWGLDVNDLRQSVAKARTEGITVRAMVIINPGNPTGQCLSEANLREILRFCF
QENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNPPKPGDISYDQYVRESKGIL
ESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAIEAAKKAGKVPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFRKFNDEFMEQYEGYSYSRM
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaaggcattagattacgagtcccttaacgaaaacgtgaagagggttcagtat
gctgttagaggcgagttgtaccttcgagcttctgaacttcagaaagaaggaaaaaagatt
atcttcacaaatgttggcaatccacatgccttgggtcagaagccactgacatttcctcgc
caggtggttgctctgtgccaagctccatttctgctagatgatccaaatgtaggattatta
tttcccgctgatgcaattgcaagagctaagcattacctttccttgacgcctggtggtcta
ggtgcatatagtgactcccgaggtcttcctgggataaggaaggaggtagctgagttcatt
gaaaggcgtgatgggtatccaagtgacccagaactcatattcctgactgatggtgcaagc
aaaggtgtgatgcaaatcttgaatgctgtcatccggggtcaaggggatggggttttggtt
ccagtcccacagtatccactttattcagctacaatatctttactcggtggttctcttgtt
ccatattatctggaagagactgcaaactggggtcttgatgttaatgaccttcgccagtct
gttgcaaaggctcgcactgaaggaataacagtaagagcaatggtgattatcaaccctggt
aaccccactggacagtgtctcagtgaagctaatttgagagaaatattgcgcttctgtttt
caagaaaacttggtgttacttggggatgaggtttatcaacaaaatatatatcaggatgaa
cgcccgttcattagttctaggaaggttttgatggatatgggaccaccaataagcaaggaa
gtccagcttgtttcttttcacactgtgtctaaaggatactggggtgaatgtgggcagcga
ggtggatattttgagatgacaaacattcctccaaagacggttgacgagatctataagatt
gcttcaatatctctcagtcctaatgtcccagcacagatatttatgggactaatggtaaac
ccaccaaaaccaggagatatttcatatgatcaatatgttagggaaagcaaaggaatactt
gaatctctgagaagaagagcaaggattatgactgatggatttaacagctgcagaaatgtg
gtctgtaatttcacagaaggtgccatgtattcatttcctcaaataaggttgccacaaaga
gcgatagaagctgccaaaaaggctggaaaagttccggatgtcttctactgccttaagctt
ttggaagccaccggcatttccactgtccctggttcaggatttggacagaaagaaggggtg
tttcacttgcggacaaccattctaccggctgaggaagacatgccagcaatcatggcgagt
ttcaggaagttcaatgatgagttcatggagcaatatgaaggctatagctactcaagaatg
tga

DBGET integrated database retrieval system