KEGG   Carica papaya (papaya): 110818355Help
Entry
110818355         CDS       T05151                                 

Definition
(RefSeq) serine/threonine-protein kinase tricorner-like isoform X1
  KO
K08790  serine/threonine kinase 38 [EC:2.7.11.1]
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpap01001]
    110818355
Enzymes [BR:cpap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110818355
Protein kinases [BR:cpap01001]
 Serine/threonine kinases: AGC group
  NDR family
   110818355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C APH Seadorna_VP7 Kdo Haspin_kinase Kinase-like Pox_ser-thr_kin COQ7
Motif
Other DBs
NCBI-GeneID: 110818355
NCBI-ProteinID: XP_021902894
LinkDB All DBs
Position
Unknown
AA seq 546 aa AA seqDB search
MEAVRSWFNKLKPKDKLKSSNKKETMGSGKEGPKTQTSEETPSTVTKQKVAAAKQYIEDH
YKKQMKNLQERKERRNMLEKKLADAEVSEEEQSNLLKRLEKKETEYMRLQRHKMGADDFE
PLTMIGKGAFGEVRVCREKATGHVYAMKKLKKSEMLRRGQVEHVKAERNLLAEVDSNCIV
KLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYVGETVLAIESIHRHNYIH
RDIKPDNLLLDKNGHMKLSDFGLCKPLDCSNLQEKDFSVGNNLSGALQSDGRPVVPKRTQ
QEQLQHWQRNRRMLAYSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGYPPFYS
DEPMSTCRKIVNWRTHLKFPEEAKLSLEAKDLISRLLCNVEHRLGTKGADEIKAHPWFKG
IEWDKLYQMKAAFIPEVNDELDTQNFEKFEEADNQIQTSTKSGPWRKMLSSKDVNFVGYT
YKNFEILNDHQLPGITELKKKSTKPKRPSIKSLFDESAVVNQPVQGSFLNLLPPQIEVPE
KESNSQ
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgtgagatcttggttcaacaagttgaaaccaaaagataagttaaagtcttca
aataagaaggaaactatgggcagtgggaaggaggggcccaaaacacaaacaagtgaagaa
acaccatcaacagtgaccaagcagaaggttgcagctgcaaaacaatacatcgaagatcat
tacaagaagcaaatgaaaaatctccaagaaaggaaagagcgacgcaatatgctggaaaaa
aagttggctgatgctgaggtctctgaggaagaacaaagcaacttactgaagcgtttggag
aagaaggaaacagaatacatgcgtcttcagaggcataaaatgggtgctgatgattttgag
ccattaacaatgataggaaagggtgcatttggagaggttagagtctgtagggagaaagca
actggccatgtatatgctatgaagaagcttaagaaatcagagatgcttcgaagaggccag
gtagaacatgtgaaagctgagaggaatctacttgcagaggttgatagcaattgcattgtc
aaactatattgttctttccaggatgaggagtatctttaccttattatggagtatctacct
ggtggagatatgatgaccttactaatgcggaaggatacgctgacagaagatgaggccagg
ttttatgttggggaaactgtacttgctattgagtctatccatagacataattatattcat
agagatatcaagcctgataacttgctgcttgataaaaatggtcacatgaagttatcagat
tttggactatgtaaaccgttagactgcagtaatctccaggaaaaggatttttctgttgga
aacaatctcagtggggctcttcagagtgatgggcgccctgtggtgccgaaacgcacgcag
caagaacaactacagcattggcagaggaataggaggatgcttgcttattccacagttgga
actcctgattatattgctccagaagttttgctgaagaaagggtatgggatggaatgtgat
tggtggtctcttggcgccattatgtatgaaatgcttgtgggatatccacccttttattca
gatgagcctatgtctacatgtaggaagatagtaaattggagaactcatttgaaattccca
gaagaggcaaagctatctctggaagcaaaagatctcatcagcagacttttatgcaatgtt
gaacataggctcggaacaaaaggcgcagatgaaattaaggctcacccgtggttcaagggt
attgagtgggacaaattatatcaaatgaaagctgcatttattcctgaagtcaatgatgaa
ctggatactcaaaactttgaaaagtttgaagaggctgacaatcaaattcagacttcaaca
aaatcaggtccatggagaaagatgctttcgtccaaggatgtaaactttgtgggttataca
tacaagaacttcgaaattttgaatgatcatcaattaccaggaattactgagctgaagaag
aaaagcacgaaacccaagaggccctctatcaagtccctttttgatgaatcagcagttgtg
aatcaacctgttcaagggagcttcttaaacctcttgcctccccaaattgaagtacctgag
aaagagagcaattctcaatga

DBGET integrated database retrieval system