KEGG   Carica papaya (papaya): 110819540Help
Entry
110819540         CDS       T05151                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase EZA1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110819540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpap03036]
    110819540
Enzymes [BR:cpap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110819540
Chromosome and associated proteins [BR:cpap03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110819540
   Polycomb group proteins
    PRC2-EZH2 complex
     110819540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GRAS SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 110819540
NCBI-ProteinID: XP_021904476
LinkDB All DBs
Position
Unknown
AA seq 961 aa AA seqDB search
MADELELRGVTELIFKNGIEQIVAMEGSERVARSVKIDVWRAFFARYRMMEMGLSESSLY
QVELIIKQFACAGYCTLEKNGKSMIVGWKGTPIHSLSAWKFSRDRFREKSHGEHSADGFG
GLQNKLNHLKRQIQAERVLSIQQRVESNRKKLETYVSHILTAASSRSSFSMEENGIGKTL
SSRIQNPLCKFNRFAQGVGDKDYANSHEVISTSIKLPYIQMIPSYTTWIFLDKNQRMAED
QSVVGRRRIYYDQHGSEALVCSDSEEELLEHEEEKHEFSEGEDRILWMVFQENELDEEVL
NIVSQFIGVKTSDIQDRYKRLKEKYDKDFRDCEDSGSERGISLDKSLGAALDSFDNLFCR
RCLVFDCRLHGCSQTLINPVSKEKQPYWSEYEDDRNPCSDQCYLQLRYVKDMPGFSSIST
LRRVKCANLEENTSSATFSNVEEPHLSDGVEIISPERCISEKEMSLILEAVPSPRVSAEA
VNTNSSIMEKKNHQDLGKRRALEDKTIAQDYSKDSSNSLQDSSSKKQKTLIALDVNLMSN
TAISSMDQISSSSVKKRHLASGTPKESKVRMTAGNVRNESDENTPEMPECTQSSSEXKPI
EKELYLKGIEIFGRNSCLIARNLLSGLKTCIEVSIYMRDNGSSVLNRSITPNSFSEDKGK
ADSDNLEQEIPTRGRLLRRRGKTRKLKYSWKSAGHPSSWKRIADGKSEFCKHYTPCGCQP
ICGKQCPCLSHGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRECDPDVCRN
CWVSCGDGSLGEPPKRGDGQCGNMRLLLRQQQRILLARSDVAGWGAFLKNPVNKNDYLGE
YTGELISHHEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKFANHSSKPNCYAKVM
LVAGDHRVGIFAKERIEASEEIFYDYHYGPAQAPAWARKPEGSKKDDSSVGQGRAKKHQS
H
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgagttggaattgagaggggtgacagagttgatattcaagaatggaatcgaa
cagattgtggcaatggaaggcagcgaaagggtggctagaagtgtgaaaatagatgtgtgg
agagcgttttttgcaaggtatagaatgatggagatgggactcagcgagtcgtctttgtat
caagttgagttaataatcaaacagtttgcctgtgctggttattgtacgttggagaagaat
gggaagagtatgattgttgggtggaaggggactccgattcattcactttctgcttggaaa
ttctctcgagatagatttagggagaaatcccatggggaacactctgctgatggttttgga
ggcttgcaaaataaattaaatcaccttaaacggcaaattcaagcagagagagttctttcc
atacaacaaagagttgagagtaacagaaagaaactagaaacttatgtttctcatattcta
acagcagcatcaagtcggagttctttctccatggaggagaatgggattggtaaaacgctg
tcttcaagaattcaaaatcctctctgcaagttcaatagatttgctcaaggggtgggagat
aaagattatgctaatagtcatgaagttatatcaacaagcatcaaactgccatatatccaa
atgataccatcatacactacatggatatttttggacaaaaatcagagaatggccgaagac
cagtctgtggttgggaggagacgtatttattatgaccaacatggcagtgaagcgctggtt
tgtagtgacagtgaagaggaacttctagaacatgaggaagaaaaacatgaattttccgag
ggtgaagatcgcattttatggatggtctttcaggagaatgagctagatgaggaagtactg
aacattgtcagccaattcattggtgtaaaaacttctgacattcaggaccggtacaagagg
ctcaaagagaagtatgataaagatttcagagattgtgaggattctggatctgaacggggt
atatctctagacaagagccttggtgctgctctagattcttttgataacctattttgtcgt
cgttgcttggtatttgattgtcgtctgcatggctgttctcaaactttaatcaatcctgta
agcaaggaaaagcagccatactggtctgagtatgaagatgaccggaacccatgcagtgat
cagtgttaccttcaattaagatatgtcaaagacatgccaggattttcgagtattagcacc
ctacgtagagtaaagtgtgcaaacttagaggagaataccagtagtgcaacattttctaat
gtggaagagccacatctgagcgatggtgtagagatcatttcacctgaaagatgtatttct
gagaaagaaatgtctttaattctggaagctgttccaagcccaagagtttctgctgaagct
gtaaatacaaattcatccatcatggaaaagaagaaccatcaagatttgggaaagcgcaga
gccttagaagataaaactatagcgcaagattactcaaaagacagttctaacagtctccag
gattcttcgagcaagaaacagaagacattgatagctttggatgtaaatttgatgtctaat
actgctatatcaagcatggatcaaatttccagttccagtgtcaagaagaggcacctagct
agtggaacccccaaagaaagtaaagttcgaatgactgctgggaatgttcgtaatgaatca
gatgaaaacacaccagaaatgccagaatgcacgcagtcatcgtctgaantgaaacctatt
gagaaagaactctatttgaagggaatagaaatatttgggagaaacagttgccttatagcc
agaaacctactttccggcttgaagacttgcatagaagtatcaatttacatgcgtgacaat
ggatcttcagttcttaacagatctattacacccaattcattttcagaggacaaagggaaa
gctgactcagataatttggagcaagaaataccaacaagaggaaggttacttcgcagaagg
ggcaaaacacgaaagctgaaatattcttggaagtctgctggccacccatcaagttggaaa
agaattgcagatggcaaaagtgaattttgtaagcattatacaccatgtggatgccagccc
atatgtgggaagcaatgtccttgtctaagtcatggaacttgctgcgaaaagtattgtggg
tgctccaagagttgcaaaaatcgtttcagaggttgccactgtgcaaagagtcaatgcaga
agcaggcagtgcccatgctttgctgctgggcgtgaatgtgatcctgatgtctgccgaaat
tgttgggttagttgtggagatggttcattgggtgagccacctaaaagaggagatggtcag
tgcggaaacatgagattgctcctaaggcaacagcagaggattctcttggccagatctgat
gttgctggatggggtgctttcttaaagaatcctgtcaacaagaatgattatcttggagaa
tatactggtgaattgatttcccaccatgaagctgataaacgcggcaaaatttatgaccgt
gcaaactcatcattcctgtttgacctgaatgatcagtatgtccttgatgcttaccgcaaa
ggagacaagctaaaatttgcaaaccactcatcaaagccaaactgctatgccaaggtaatg
cttgtggcaggagatcaccgagttggcatctttgccaaggagcgtattgaagctagtgaa
gagattttctatgattaccattatggaccagcccaagcacccgcatgggcccgaaaacct
gagggttcaaagaaagatgactcatctgttggtcaaggtagagcaaagaaacaccaatct
cactaa

DBGET integrated database retrieval system