KEGG   Carica papaya (papaya): 110821987Help
Entry
110821987         CDS       T05151                                 

Definition
(RefSeq) glutamate decarboxylase 5
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00250  Alanine, aspartate and glutamate metabolism
cpap00410  beta-Alanine metabolism
cpap00430  Taurine and hypotaurine metabolism
cpap00650  Butanoate metabolism
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
Module
cpap_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110821987
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110821987
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110821987
   00430 Taurine and hypotaurine metabolism
    110821987
Enzymes [BR:cpap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110821987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110821987
NCBI-ProteinID: XP_021907671
LinkDB All DBs
Position
Unknown
AA seq 483 aa AA seqDB search
MAITTKVTDSEEYLHSTFASRYMRAPVPRFKLPERSMPKEAAYQVINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMDSINKNYVDMDEYPVTTELQNRCVNMIANLFHAPVGDDEAAVG
VGTVGSSEAIMLAGLAFKRKWQHKRRSQCQPFDKPNIVTGANVQVCWEKFARYFEVELKE
VKLTEGCYVMDPAKAVEMVDENTICVATILGSTLTGEFEDVKLLNQLLSEKNDETGWDIP
IHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDDL
VFHINYLGADQPTFTLNFSKGSNQIIAQYYQFIRLGFDGYKNIIQNCMENARVLREGIEK
TERFEILSKDVGVPLVAFRLQDSSKHTVFELAESLRRFGWIIPAYTMPADAQHVAVLRVV
IREDFSTGLAERLINHLNQVLKEMDTLPSRMPVTPNPNPPKHSHQDIIRYWRRLVDHKRN
GVC
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcacgaccaaagtcaccgactccgaagagtatttgcactccacttttgcttcc
agatatatgcgtgctcctgttcccagattcaagttgccagagcggtcaatgccaaaagaa
gcagcataccaagtaataaacgatgagttgatgttagacggaaatcccaggctaaacttg
gcatcctttgtgacgacatggatggagcctgagtgcgacaagcttatgatggactccatt
aacaagaactatgttgacatggatgagtatcctgttactactgagcttcagaatcggtgt
gtaaatatgattgccaacttattccatgctccagttggagatgatgaagctgcagttggt
gtgggaactgtgggttcatcagaggcgataatgttggctgggttagctttcaaaagaaaa
tggcagcacaagagaagatcacaatgtcaaccttttgataaacccaatattgtcacagga
gctaatgtgcaggtgtgctgggaaaagtttgcaaggtactttgaagtggagctgaaggag
gtgaaactgactgagggatgttacgtgatggacccagcgaaagcagtggagatggttgat
gagaataccatctgtgtagccaccattcttggatcaaccttgactggagagtttgaagat
gtaaagcttctgaaccagctgctttctgagaagaatgacgaaactggttgggatatccca
attcacgtagatgcagctagtggaggattcatcgctccttttctttacccagatctcgag
tgggatttccggttgccgttggtcaaaagcatcaacgtaagcggccacaagtatgggctg
gtctacgccggagttggttgggttgtttggagaacaaaagatgacttgcctgacgatctt
gtttttcatatcaactatcttggagctgatcaacccacttttactctcaacttttctaaa
ggatctaatcaaattattgctcagtactatcaattcattagacttggcttcgatgggtac
aagaacataatacaaaactgcatggaaaatgctcgagtgttgagagaaggaatagagaaa
acggagcgatttgagattctatcaaaggatgtaggggttccacttgtggcattcaggctt
caggatagcagcaagcacacggtgtttgagcttgcagagagcctacgaagattcggttgg
ataattcctgcctacacaatgccagcagatgcgcaacatgtggcagtgctgcgggtggtg
attagggaggacttcagcacagggctcgcagagagactaatcaatcatctcaaccaggtt
ttgaaggaaatggataccctccctagccgcatgcctgtgactcctaatcctaatcctcct
aaacattctcatcaggacattatcaggtattggcgccgtcttgtggaccacaaacgaaat
ggtgtgtgctga

DBGET integrated database retrieval system