KEGG   Carica papaya (papaya): 110822288Help
Entry
110822288         CDS       T05151                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00020  Citrate cycle (TCA cycle)
cpap00190  Oxidative phosphorylation
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
cpap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110822288
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110822288
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110822288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-GeneID: 110822288
NCBI-ProteinID: XP_021908057
LinkDB All DBs
Position
Unknown
AA seq 633 aa AA seqDB search
MWRCVSRSLRVPSSRRSVANDSLGSRMSRLFCTDSTGGRSSYTVVDHTYDAVVVGAGGAG
LRAATGQSEHGFNTACITNLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMSSDGSCQGVMALNMEDGTLHRFHAAST
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGVPTNHHGEVVTIRGNDPDAV
VPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHRPGEKQKPLEKDAGEK
TIAWLDKIRNANGSIPTSKIRLNMQRVMQTNAAVFRTQETLEEGCQLIDKAWESFHEVKL
KDRGLIWNSDLIETLELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLG
YWENERVRLDYRPVHMNTLDDEIESFPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtagccttcgagttccttcttctaggagatccgtcgcgaat
gactctcttggatctcgcatgtccagattgttctgcactgattcgactgggggacgatcc
tcatatacagtagtagatcatacatatgatgcggtcgttgttggggctggtggtgctgga
ctgcgtgcagcaacagggcaatctgagcatggatttaacactgcttgcatcaccaacctt
ttcccaactcgttcacatactgttgccgcccagggtggtataaatgctgcattgggaaat
atgactgaagatgactggagatggcacatgtatgatacagtgaaggggagtgattggcta
ggtgatcaagatgccattcaatacatgtgtagggaggcaccaaaagcagtgattgagctt
gagaattatggtttaccattctctcgaacagaagatgggaaaatataccagcgagcattt
ggtggtcagagccttgattttggaaaaggtggacaggcataccgttgtgcatgtgctgct
gatcgaactgggcatgctttgttgcacacactctatggccaagcaatgaaacataatact
cagttctttgttgaatattttgctttggatttgataatgagcagtgatggtagttgccaa
ggagtaatggcattaaacatggaggatggcacattacatcgtttccatgctgcttcaaca
attttggctacaggggggtatggtagagcctacttttctgcaacttccgcacatacatgc
actggagatggcaatgccatggtcgcacgtgctgggctccctctgcaggatttggagttt
gttcagtttcacccaacaggcatatatggagctgggtgtctcattactgaaggatctcga
ggtgaaggtggcattcttagaaacagcgaaggtgaacgattcatggagcggtatgcccct
acagccaaagatcttgcttccagagatgttgtctcgaggtctatgactatggaaattagg
gaaggtcgtggtgtaggacctctgaaggaccatatctatctccatttgaatcacttacca
ccagaggtactcaaggaaaggcttcctggaatctctgaaactgccgctatctttgctggt
gtggatgttacaaaggagcccatccctgtcttacccactgttcactataatatgggtgga
gttcctacaaatcaccatggggaggtagttactattagaggcaatgatccagatgctgta
gttcctgggttaatggcagctggggaggcagcctgtgcgtcagttcatggtgctaataga
cttggtgctaattcccttcttgacattgttgtttttggtcgagcatgtgctaacagagtt
gctgagatacatagaccaggggagaaacagaaacctctggaaaaagatgctggtgagaaa
acaattgcttggctggacaaaataagaaatgcaaatggttcaattccaacttccaaaatc
cggttgaatatgcagagggtgatgcaaactaatgcagctgtcttccgtacacaggaaaca
ttagaagaaggttgtcagttaattgacaaagcatgggagagtttccatgaagtgaagctg
aaagatcgtggtttgatatggaactctgacttgatagagactctggagttggaaaacctt
ttgataaatgcctgtatcaccatgcattctgctgaagccaggaaagagagcagaggagca
catgcccgggaagattttacgaaaagagatgatgagaactggatgaagcacacactggga
tattgggagaatgagagggtgcggctagattataggccagttcacatgaacactttggac
gacgaaattgaatcattccctcctaaagctcgtgtgtattga

DBGET integrated database retrieval system