KEGG   Carica papaya (papaya): 110823954Help
Entry
110823954         CDS       T05151                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110823954
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110823954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 110823954
NCBI-ProteinID: XP_021910155
LinkDB All DBs
Position
Unknown
AA seq 221 aa AA seqDB search
MQAVIAVMATHTILAATSSHISFAPFASPASSPSHPLRTSFLVVPLKLHRQSISLSAVAP
KPFSVVAATKKAVAVLKGNSSVEGVVTLTQEDDGPTTVNVRVTGLTPGLHGFHLHEYGDT
TNGCMSTGAHFNPNNMTHGAPGDEIRHAGDLGNIIANADGVAEATIMDSQIPLSGPNSVV
GRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgtaatagcagtcatggcgacgcacaccatcctcgcagcaacatcatctcac
atttcgttcgccccattcgcaagccctgcgtcgtcaccgtcgcatcctctccgaacctca
ttccttgtggtccccctcaagctccatcgacagtctatatctctctctgctgtagctccg
aagcccttctctgttgtggctgccaccaagaaagctgttgctgtcctcaagggtaactcc
agtgtcgaaggcgttgtcacgttaacccaagaagacgacggtcctacaactgtgaacgtt
cgtgttactgggcttactccaggactgcatggattccacttacatgagtatggtgataca
acaaatgggtgcatgtctacaggagcacatttcaatccgaacaatatgactcatggtgct
cctggtgatgaaatccgtcatgcgggtgacctgggaaacataattgctaatgctgatggg
gtggcagaggcaacaatcatggacagtcagataccattaagtggacctaattcagtagtt
ggaagagcatttgtagttcatgagcttgaggatgaccttggaaagggtggccatgaactt
agtctaaccactgggaatgcaggcggaagattagcttgtggtgtcgttggcttaactcca
gtgtga

DBGET integrated database retrieval system