KEGG   Carica papaya (papaya): 110824906Help
Entry
110824906         CDS       T05151                                 

Definition
(RefSeq) cytochrome P450 71A1-like
Organism
cpap  Carica papaya (papaya)
SSDB OrthologParalogGFIT
Motif
Pfam: p450 COMM_domain
Motif
Other DBs
NCBI-GeneID: 110824906
NCBI-ProteinID: XP_021911085
LinkDB All DBs
Position
Unknown
AA seq 364 aa AA seqDB search
MLLYFGYTPTLVVSSADMAREILTTHDIVFSNRPRTLAANILLYGCKDVGFSPYGEYWRQ
ARKICVVELLSLKRVNSFQHVRDEEVAEVIESIQRTCLCGSLINLSELFSVLSANTVSRC
VIGRKVNEIGGNIKLGELANKLTKEINEFGFSDRLPYFYLGYLMDILTGLVARLKKTSKE
FDIFLDQVIDEHMTLENSNDEEPLDNKKKNFVHILLQLQQNNSLDFELTREKIKAILLDM
FVAGIDTTSTTLEWTMAELIRNQNILKKAQDEVRRVVGNKSKVEGNDINMMNYLKCTIKE
SLRLHPPAPLLLPRETSKAINLGGYDIPPKTSVIINAMKIQKDPNIWERPEEFMPERFEE
NPVE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgctcctctactttggctatactccaactcttgttgtatcgtcagcagatatggcacgt
gaaatacttacgacccatgatattgttttctctaatcgacccagaactctagctgcaaat
attttattatatgggtgtaaagacgtagggttttctccctatggtgaatattggaggcaa
gctaggaaaatttgtgtcgtggagctattgagcctcaaacgtgtgaattctttccaacac
gtgcgagatgaagaggttgcagaagtgattgaaagcatacaacgcacctgtctctgtgga
agcttaatcaatctaagcgagctatttagtgttctttctgctaacacagtgtctagatgt
gttattggaagaaaagttaacgagattggagggaatatcaagttgggagagttggcaaat
aagttgaccaaggaaattaatgagtttggttttagtgatagacttccatatttttatttg
ggatacttgatggatattttaactggtttagttgcacgtttgaaaaaaacttcaaaagaa
tttgatatttttctagatcaagtcatcgatgaacatatgactttggaaaatagtaatgat
gaagaaccactcgataataagaaaaagaattttgttcatatattacttcaacttcaacag
aataactcgcttgactttgaattgacgcgggagaaaatcaaagcaatactactggacatg
tttgttgcaggaatcgacacaacttcgacaacacttgaatggacaatggcggagttgata
agaaaccaaaatatactaaaaaaagcccaagacgaggtacgaagagtggtggggaataaa
tcaaaggtagaaggtaatgatataaacatgatgaactacttgaaatgcaccattaaagag
agtttgagattgcatcctcctgcacctctcttgcttcctcgagaaacatctaaagccatc
aatctgggtggctatgatattcctccaaaaacaagtgtgattatcaatgcaatgaaaatc
caaaaagatcccaatatatgggagaggccagaagagttcatgccagagaggtttgaagag
aatccggtggaataa

DBGET integrated database retrieval system