KEGG   Citrobacter pasteurii: CUC49_02825Help
Entry
CUC49_02825       CDS       T05874                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cpar  Citrobacter pasteurii
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CUC49_02825
Enzymes [BR:cpar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CUC49_02825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like NAD_binding_8 FAD_oxidored Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C FMO-like Glutaredoxin DAO
Motif
Other DBs
NCBI-ProteinID: AYL60655
LinkDB All DBs
Position
611005..612570
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLTEIAELSEKVTFKEDNTLDV
RKPSFLITNPGSHQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYMNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDSQSASKLVPAAQEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQNKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDIHNVELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTTTV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcaaggcttatcttgagaaactgaccaaacct
gttgagctgattgctacgctggatgacagcgctaaatcggcagaaatcaaggaactgctg
actgaaattgctgaactgtcagaaaaagtcacctttaaagaagataatactctggacgta
cgtaagccatcgttcctgattaccaatcctggttctcaccaggggccgcgctttgccggt
tctccgctggggcatgagtttacctctctggttctggcgctgttgtggaccggtggtcat
ccgtcaaaagaggcacagtcactgctggagcagatccgcgacctcgacggggactttgag
tttgaaacctattattcgctttcctgccataactgcccggatgtggtgcaagcgctcaac
ctgatgtctgtacttaacccacgcatcaagcatacggcgattgatggcggtacattccag
aacgaaattaccgatcgtaacgtcatgggcgtaccggcggtctatatgaacggcaaagag
ttcggccagggtcgtatgacgctgactgaaatcgtagcgaaagtggataccggtgcagaa
aagcgcgcagcggaagagttgaataagcgtgatgcttacgatgtgctgatcgtcggttcg
ggtcctgccggggcagcggctgcggtgtactctgcacgtaaaggtattcgcaccggtctg
atgggcgaacgctttggcggtcaggttcttgataccgttgatatcgaaaactacatctct
gtaccgaaaaccgaaggccagaaactggctggcgcactgaaagcacatgttgatgattac
gatgttgatgttattgatagccagagtgcgagcaaactggttccggcagctcaggaaggt
ggtttgcatcagattgaaacggcttccggcgcggtgttgaaagcacgcagcatcatcatt
gctaccggtgcaaaatggcgcaacatgaatgttccgggtgaagatcagtatcgcaccaag
ggcgtaacctactgtccgcactgtgatggcccgctgtttaaaggcaagcgtgtcgcggtg
ataggtggcggtaactcgggtgttgaagcggctatcgatctggcgggtatcgtcgagcac
gtgacgttgctggaatttgccccggaaatgaaagccgatcaggttctgcagaataaagtc
cgcagtctgaaaaacgtcgacattattctgaatgcgcaaaccacagaagtgaaaggcgac
ggcagtaaagtcaccggtctggagtatcgtgaccgcgtcagcggtgatatccacaatgtg
gaactggcgggtatctttgtgcagattggcctgttgccaaataccaactggctggaaggc
gccgttgagcgtaaccgcatgggtgaaatcatcattgatgccaagtgcgagaccagcgtg
aagggcgttttcgcggccggagactgcaccaccgtaccgtataagcagattatcattgcg
actggcgaaggtgccaaagcatcattgagctcgtttgattatctgattcgcaccacaacc
gtataa

DBGET integrated database retrieval system