KEGG   Citrobacter pasteurii: CUC49_06180Help
Entry
CUC49_06180       CDS       T05874                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
cpar  Citrobacter pasteurii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Cupin_2 Pyr_redox ThiF
Motif
Other DBs
NCBI-ProteinID: AYL61251
LinkDB All DBs
Position
1297884..1298927
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILKTPGTMKIIAADIPVPKEHEVLIKVEFVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGNRVTKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPNNMDTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATDIAVVDVLDKRLTMAEQLGATTVINGAKEDTVARCQQFSGDMGADI
VFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVSIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYADVQRAFDESVNNKSEIIKGVIKVNH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaacgccgggcacgatgaaaattattgccgccgat
atcccggtgccaaaagagcacgaagtgctgattaaagtggaattcgttggcatttgtggg
tcagatgtacatggttttgaatcgggtccttttattccgccgaaagatcccaatcaggaa
attggtctggggcatgaatgcgccggtacggtggtggcagtagggaaccgtgtgactaaa
tttaaacccggcgaccgggtgaatatcgaaccgggtgtgccgtgcggtcactgccgctac
tgtctggaagggaaatacaacatctgccctgatgttgactttatggccacgcagcctaat
tatcgcggcgcgctaacccactatctgtgccatccggagagcttcacttacaagttaccc
aataatatggacaccatggaaggcgcgctggtagagcccgcggcggtagggatgcatgcc
gcaatgctggcggacgttaaaccgggcaaaaaaatcgtcattctgggggcgggctgtatt
ggtttaatgaccctgcaagcctgtaaatgtttgggtgctaccgacattgcggtggttgat
gtgctggacaaacgtctgaccatggccgagcagcttggcgcgacgaccgtgatcaacggg
gcgaaagaggacaccgttgcccgctgccagcagttctccggagatatgggggccgatatt
gtttttgaaaccgcaggttcagcgatcactgttaagcaggctccatatctggtaatgcgc
ggcgggaaaatcatgatcgtgggtactgtacctggtgattcagcgattaatttcctcaaa
attaaccgtgaagtgtctattcagaccgttttccgttatgccaaccgctacccggtcacg
attgaagccatctcctcagggcgttttgatgtgaagtcgatggtgacgcatatttacgat
tatgcagatgttcagcgcgcgtttgatgaatccgttaataacaaaagcgaaattattaaa
ggcgtaattaaagtaaatcattaa

DBGET integrated database retrieval system