KEGG   Citrobacter pasteurii: CUC49_07290Help
Entry
CUC49_07290       CDS       T05874                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00480  Glutathione metabolism
cpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CUC49_07290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpar02000]
    CUC49_07290
Enzymes [BR:cpar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CUC49_07290
Transporters [BR:cpar02000]
 Other transporters
  Pores ion channels [TC:1]
   CUC49_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_2 GST_C_2 GST_C_3 GST_N GST_N_3 Glutaredoxin2_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: AYL61455
LinkDB All DBs
Position
complement(1508771..1509376)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFFAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADTVPDRHLLAPTSSLSRYKTIEWLNYIATELHKGFTPLFRPDTPEE
YKPTVRALLEKKMQYVNESLKDNPWICGARFSIADAYLFTVLRWAYAVKLNMAGLSHIEA
YMARMAERPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggcgcttgttctctcgcttcccacatcacacttcgtgag
agcggtaaagatttcactctggatggtgttgatctgatgaagaaacgcctggaaaacggc
gacgattttttcgcggtaaacccgaaaggacaagttcccgcactgttgctggatgatggt
acactactgaccgaaggcgtcgccatcatgcaatatctggctgataccgttccagaccgt
catctcctggcccctaccagcagtctctcccgctacaaaactatcgaatggcttaactat
atcgctacagagctacataaaggttttaccccactgttccgcccggacacgccagaggag
tacaaaccaaccgtacgcgcattgcttgagaaaaaaatgcagtatgtgaacgaatcgctg
aaagacaacccgtggatttgcggcgcacgcttcagcattgctgatgcctatctgtttacc
gtgctgcgttgggcgtatgcggttaagttgaatatggcaggattaagccatatcgaggcg
tatatggcgcgcatggctgaacgcccggcggttgccgcagcgcttaaagcggaaggatta
aattaa

DBGET integrated database retrieval system