KEGG   Citrobacter pasteurii: CUC49_07965Help
Entry
CUC49_07965       CDS       T05874                                 

Gene name
fdxH
Definition
(GenBank) formate dehydrogenase subunit beta
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
cpar  Citrobacter pasteurii
Pathway
cpar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CUC49_07965 (fdxH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_2 Fer4 Fer4_21 Fer4_4 Fer4_16 Fer4_3 Fer4_17 Fer4_13 Fer4_18 Fer4_20 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AYL61580
LinkDB All DBs
Position
complement(1641596..1642480)
Genome map
AA seq 294 aa AA seqDB search
MSMETQDIIKRSATNSITPPPQARDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIHFGTKQEMLEMGEQRVAKLKARGYEHAGLYNPEGVGGTHVMYVLHHANQPELYHGL
PKEPKIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIGPNKEVDDDEEDHHE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtctatggaaacgcaggacatcatcaaacggtccgcaacaaactccatcacgccgccg
cctcaggcccgtgattacaaagccgaggtcgcgaagctgatcgacgtttccacctgtata
ggctgtaaggcctgtcaggtggcatgctcagagtggaacgatatccgcgatgaagtcggc
cactgcgtcggggtgtatgacaaccccgccgatctcagcgccaagtcctggacggtgatg
cggtttaccgaaaccgaacagaacggcaagctggagtggttgattcgtaaagatggctgt
atgcactgtgaagatccgggctgcctgaaggcgtgtccgtctgccggggcaatcatccag
tacgccaacgggattgttgatttccagtcagagcattgcattggttgcgggtactgtatt
gccgggtgtccatttaatattccgcgcctcaataaagaggataaccgcgtgtataaatgt
acgctgtgtgtggatcgcgtcagcgttgggcaagaacctgcctgcgtgaagacctgtcca
accggggcaatacatttcggcactaagcaggaaatgctggaaatgggcgagcagcgtgtg
gcaaaactgaaagcacgtggttatgaacatgccggtctctacaacccggaaggtgtggga
ggcacgcacgtcatgtacgttctgcatcatgccaaccagccggagctgtatcacggtctg
ccgaaagagcctaagatcgatacctctatcaatctgtggaaaggggctctgaaaccgctg
gctgctgccggatttatcgctaccttcgccgggctgatttaccactacattggcatcggc
ccgaataaggaagtggacgacgacgaggaggatcatcatgagtaa

DBGET integrated database retrieval system