KEGG   Citrobacter pasteurii: CUC49_13735Help
Entry
CUC49_13735       CDS       T05874                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00250  Alanine, aspartate and glutamate metabolism
cpar00280  Valine, leucine and isoleucine degradation
cpar00310  Lysine degradation
cpar00410  beta-Alanine metabolism
cpar00640  Propanoate metabolism
cpar00650  Butanoate metabolism
cpar01100  Metabolic pathways
cpar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CUC49_13735
   00650 Butanoate metabolism
    CUC49_13735
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CUC49_13735
   00280 Valine, leucine and isoleucine degradation
    CUC49_13735
   00310 Lysine degradation
    CUC49_13735
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CUC49_13735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpar01007]
    CUC49_13735
Enzymes [BR:cpar01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CUC49_13735
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CUC49_13735
    2.6.1.48  5-aminovalerate transaminase
     CUC49_13735
Amino acid related enzymes [BR:cpar01007]
 Aminotransferase (transaminase)
  Class III
   CUC49_13735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AYL62625
LinkDB All DBs
Position
2817459..2818742
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAVPRGVGQIHPIFAERAENCRVWDVEGREFLDFAGGIAVLNTGHLHP
QIVSAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKRVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRTGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCPLHGISD
DDAIASIYRIFKNDAAPEDVAAIVIEPVQGEGGFYAASPAFMQRLRAICDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRADVMDAIPPGGLGGTYAG
NPIACAAALAVLNIFEQEDLLQKANELGQTLREGLLAIAETHREIGDVRGLGAMIAIELF
EDGDHTKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLDIIAQC
FDEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaacaaagaactaatgcaacgtcgcagcaacgccgttccccgtggcgtaggc
cagatccaccctatttttgccgagcgggcagaaaactgtcgggtctgggacgttgaaggc
cgtgaattccttgactttgctggcggtattgcagtgttgaacaccggtcacctgcacccg
cagatcgtctctgcggtagaagcgcagttgaaaaagctgtcccatacctgtttccaggta
ctggcctatgagccatacctggagctgtgcgaaatcatgaataagagagtgccgggtgat
ttcgccaagaaaaccttgctggtgaccaccggttctgaagcggtagaaaatgcggtgaaa
atcgcccgcgccgccaccaaacgcaccggcacgatcgcctttagtggggcttaccacggc
cgtacccactacaccttgtcactgaccgggaaagtgaacccatactctgccggaatgggg
ctgatgccgggccacgtatatcgcgcgctttatccttgcccgctgcacggcatcagtgac
gacgatgctatcgccagcatttaccgcattttcaaaaacgatgccgcaccagaagacgtc
gccgccatcgtaattgaacccgtccagggcgaaggtggtttttacgccgcttctcctgct
tttatgcaacgtctgcgcgccatttgtgacgaacacgggatcatgctgattgctgatgaa
gtacagagcggtgcgggccgcaccggtacgctgtttgccatggagcagatgggcgttgcg
cccgatctcactaccttcgccaaatccatcgccggcggcttcccgctggcaggcgtgacc
ggacgcgccgacgtcatggacgctattccaccgggcggtctgggcggtacctatgccggt
aacccaattgcctgtgccgccgcgctggcggtactaaacattttcgagcaggaagatctg
ctgcaaaaagccaacgagctggggcaaacccttcgcgaaggcctgctagctattgcggaa
acccaccgcgagattggcgacgtacgcgggctgggcgcgatgattgcaatcgaactgttc
gaagatggcgaccacacgaaaccagacgctaaactgaccgccgaaattgtcgcgcgtgcg
cgtgataaagggctaatcctcctctcctgcggaccgtactacaacgtgctgcgcatcctt
gtcccgctgaccattgaagatgcgcaaatccgccaggggctggacattatcgctcaatgc
tttgatgaagctaagcaaggttaa

DBGET integrated database retrieval system