KEGG   Citrobacter pasteurii: CUC49_16295
Entry
CUC49_16295       CDS       T05874                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00052  Galactose metabolism
cpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CUC49_16295
Enzymes [BR:cpar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     CUC49_16295
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C MTS ADH_zinc_N_2 TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N Methyltransf_25 PrmA CoA_binding Pyr_redox_2 ELFV_dehydrog Methyltransf_31 Methyltransf_11 Pyr_redox Met_10 Shikimate_DH 3HCDH_N Fer4_4
Other DBs
NCBI-ProteinID: AYL63076
LinkDB
Position
3320023..3321066
AA seq 347 aa
MKSVVIHAEGDVRVEERPMPQLQADNDVLVRVVSSGLCGSDIPRIFSHGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVTCVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLAMQCA
RELGAKSVTAIDINPQKLTLAKELGATHVFNSREIGAAEIYSALADMQFDQLVLETAGTP
QTVALSVEIAGPRAQVALVGTLHQDLTLTSSVFGQILRKELTILGSWMNYSSPWPGEEWE
TAARLLTEKRLQLEPLIAHSGDADSFAKAVTSLNGAPMQGKILLKFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtacgcgttgaagaacgtcccatgccc
caactgcaagccgataacgatgtattggtcagggtggttagttcaggactttgcggttct
gatatcccgcgtattttctctcatggtgcgcattattacccaataacgctgggtcatgaa
tttagcggttatgttgaatcctacggcactggcgttactgatatgcaaccaggcgacgcc
gttacctgtgtgccgctgctcccctgcttccactgtcctcagtgtgagcgtggttatttt
tcgttatgtaagcaatatcagtttgtcggttcgcgtagcgaagggggcaatgcggaatat
gtggtcgtaaaacgcgccaatctgttccgactgccatcagatatgccgattgatgacggg
gcattcatcgaaccgattaccgtcggtttgcatgccttccatctggcccagggctgcgaa
ggcaaaaacgtgattatcgttggcgcaggcactatcggtttgctggcgatgcaatgtgcc
cgcgaactcggtgcaaaaagtgtcacggcaattgatatcaacccacaaaaattgacgtta
gcgaaagagttgggagccactcacgtattcaatagccgggagataggcgcggcggaaatc
tattctgcactggccgatatgcagttcgatcagcttgtactggagacagcaggaacacca
caaaccgtagccctgtctgtagaaattgcaggccctcgcgcacaggtagcgttagtgggt
acattgcatcaggacctgacgctgacttccagtgtatttggccaaatactgcgtaaggaa
ttaacgattctcggcagttggatgaactactccagcccatggccaggagaggagtgggaa
accgctgcacgcttgctgaccgaaaaacgtttacagctggagccgttaattgcccatagc
ggcgatgctgacagttttgccaaagcggtaacatcgctcaatggcgcaccgatgcaggga
aaaattctgctcaaatttgcctga

DBGET integrated database retrieval system