KEGG   Citrobacter pasteurii: CUC49_17645Help
Entry
CUC49_17645       CDS       T05874                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00564  Glycerophospholipid metabolism
cpar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CUC49_17645
Enzymes [BR:cpar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CUC49_17645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AYL63323
LinkDB All DBs
Position
3572547..3574055
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALVEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPSS
TGLRFGADSVMKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKHTWQARGLVNATGPWVKEFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDESEINYLLKVYNAHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYQGIGPAWTKECILPGGDIGGDREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWVIGEATSLAELGEDFGHEFYEAELKYLVDHEWVRRAEDALWRRTKEGMWLNAE
QQSRMTQWLAEYIEKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggaggcatcaacggtgccggtatcgcggca
gatgccgctggacgcggtttatccgtgctgatgctggaagcgcaggatttagcctgcgcc
acctcttccgctagctccaaactcatccacggtggcctgcgctacctggaacactacgaa
tttcgtctggtgagcgaagcgctggtcgaacgtgaagtgctgttgaaaatggcaccacat
atcgccttcccgatgcgctttcgtctgccccaccgcccgcacctgcgtccggcgtggatg
atccgcattggtttgtttatgtacgatcatctgggcaaacgcaccagtttgccaagttct
accggtttgcgttttggcgcagattccgtaatgaaacctgagattgtgcgcggtttcgaa
tattctgactgctgggtagacgatgcacgactggttttggcaaacgcccaaatggttgta
cgcaaaggcggagaagtattaacccgcactcgcgccacctctgctcgccgtgaaaacggt
ttgtggattgttgaagctgaagatatcgataccggcaaaaaacacacctggcaggcgcgt
ggcctggtcaacgccaccggtccgtgggtgaaagagttcttcgacgacggtatgcacctg
ccatcgccgtacggtattcgcctgatcaaaggcagccacatcgtggtgccgcgcgtacat
acccagaagcaggcttatattctgcaaaacgaagataaacgcattgtgtttgttatccca
tggatggacgaattctcgatcatcgggacgacagacgttgaatacaaaggcgatccgaaa
gcggtgaaaattgatgaaagcgagatcaattacctgctgaaggtttacaacgcgcacttt
aagaagcagctgggccgtgatgatatcgtctggacttactcgggcgtgcgtccgctgtgc
gatgacgagtctgactcaccgcaggcgatcacccgtgattacacgctggatatccacgac
gaaaacggcaaagcgccgctgctgtcggtctttggcggtaagctgacgacctatcgtaag
ctggctgagcacgcgatggaaaaactggcatcgtactatcagggcattggtccggcgtgg
acgaaagagtgcattctgccaggcggtgacattggcggcgatcgcgaagactacgcggcc
aaactgcgccgtcgctacccgttcctgaccgagtcgctggcgcgccattattctcgcacc
tacggcagcaacaccgaatgggtcatcggcgaagccacctcgcttgccgagttaggtgaa
gactttggccatgagttttatgaggccgagctgaaatatctggtcgatcacgaatgggtt
cgtcgtgcggaagatgcgttgtggcgccgtacgaaagaaggtatgtggctgaacgctgag
cagcagtcacgcatgacccagtggctggctgaatacattgagaagcaccagctgtcgctg
gcgtcctga

DBGET integrated database retrieval system