KEGG   Clostridium pasteurianum BC1: Clopa_1534Help
Entry
Clopa_1534        CDS       T02645                                 

Definition
(GenBank) anthranilate synthase
  KO
K13503  anthranilate synthase [EC:4.1.3.27]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01130  Biosynthesis of antibiotics
cpas01230  Biosynthesis of amino acids
Module
cpas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_1534
Enzymes [BR:cpas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Clopa_1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind GATase Peptidase_C26 Anth_synt_I_N BRCT_3 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AGK96474
UniProt: R4K7G8
LinkDB All DBs
Position
1573810..1575996
Genome map
AA seq 728 aa AA seqDB search
MYNFTENTNCKSEYITKGGIKVIRTKESLKDDDSIAKISKKLVHNKGAIFASDYEYPNRY
SRWEFAFTNPCLELRCFQRKFTINSLNKRGDLLLDIIACKLKEIKEVEICVESKEHIEGI
VQEANEFFCEEDRSKQVSVFLIIRKIKDIFESKEDSNLGLYGAFGYDLVFQFEPEIELKK
ERSDKQQDLVLYLPDRLTVVDNESKDGYVLSYEFTTAKGSTEGLKRIERLNNNKIQQCEN
FNNESSKLGEYASIVSKALDSFRKGDLFEVVPSHLLSKEINMTADEIFYNLREINPSPYG
FFINLGDKFLVGSSPEMYVRVEKNRVETCPISGTTKRGKNAIDDSEQIKKLINSNKDEEE
LTMCTDVDRNDKSRICIPGSVKVIGRRQIEMYSHLIHTVDHVEGYLNDEYDCIDAFLTHM
WAVTITGSPKRAAIEWIEEQEKAPREWYGGAVGYILFNGDMNTGLTLRTIRIKNNIAQVR
VGATLLIHSQPNEEEEETYTKAAALLESLNRKESLIKDNEKREVDFNVCKNKKILIVDHE
DSFVNTLASYIKQLGAHTVTLRYDLAENVLKEDSFDAVVLSPGPGRPKRFNLSNTIKLCL
NKKIPIFGVCLGMQGLIEYFGGKLKQLNYPRHGKKLNVKNDLSFNVWSDIGENLQAGLYH
SIYCDNIPDSFNIIAKDEEGIAMGIQHKQLPIIAVQFHPESILTAAGNSGIKLLNNVFEE
LFNFYTVK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
ttgtataacttcactgaaaatactaattgtaaatctgaatatattacaaaaggaggtatt
aaggttattagaacaaaagaatccttaaaggatgatgattctatagctaaaatttctaaa
aagttggttcacaataaaggagcaatttttgcaagtgattatgagtacccaaatagatat
tcaagatgggaatttgcttttacaaacccctgcttagaacttagatgttttcaaaggaaa
tttactattaattcacttaataaaagaggtgatttattactagatataatagcctgtaaa
ttaaaagaaattaaagaagtggaaatatgtgtggaaagtaaagaacatattgagggaata
gttcaagaagctaatgaatttttttgcgaagaggatagaagtaaacaagtatcagtattt
ttaattattagaaagataaaagatatatttgaatcaaaagaagatagtaatcttggacta
tatggagcatttggatatgatttagtatttcaatttgaaccagaaattgaactaaaaaaa
gagagatcagataagcagcaagatttagttctgtatttaccagataggctgactgtagta
gataatgagtcaaaagatggatatgttttaagttatgaatttacaacagctaaaggtagt
acagaaggtttaaaaaggatagaaagattaaataataataaaatacaacaatgtgaaaat
tttaataacgaaagttctaaattaggagaatacgcaagtatagtaagcaaggctttagat
tcatttagaaaaggtgatctatttgaagttgttccttcccatttattatcaaaagaaatt
aatatgactgctgatgaaatattttataacttgagagaaattaatccaagtccatatggt
ttttttattaatttgggagataaatttttggtgggaagttctccagaaatgtatgtaaga
gttgaaaaaaacagagtggagacatgtcctatatctggaactacaaaaagaggaaagaat
gcaattgacgattcagagcaaattaaaaaattaatcaattccaataaagatgaagaagag
ttgactatgtgtacagatgtggatcgtaatgataaatccagaatatgtataccaggttct
gtaaaggtaattggtagacgtcaaatagaaatgtactcacatttaattcatactgtagac
catgtagaaggatatcttaatgatgaatatgattgtatagatgcttttttaactcatatg
tgggcagttacaataacaggatcgcctaaaagagctgccatagaatggattgaggagcag
gaaaaagcaccaagagaatggtatggaggtgctgttggttatattttattcaatggtgat
atgaatacaggattaacccttagaactataagaattaagaataacattgcacaggtaagg
gttggagctacgctattaatccattcacagcctaatgaggaagaagaggaaacttacaca
aaggcagcagcgttactggaaagtttaaatcgcaaagaaagtttaataaaagataatgaa
aaacgtgaagttgattttaatgtatgtaaaaataagaaaatattgattgtagatcatgaa
gattcctttgttaacacattagctagttatattaaacaattaggagctcatacagtaact
ttaagatatgatttggctgaaaatgtattaaaagaagatagttttgatgcagttgtatta
tcaccaggaccgggaagacctaaaagatttaatttatcaaatacaataaaattatgtttg
aataaaaaaatacctatatttggagtatgcctagggatgcagggattgatagagtatttt
ggtggaaaattaaaacagcttaattatcctagacatggtaagaagcttaatgttaaaaat
gacttatcatttaatgtatggagtgatataggagaaaatttacaagctggactatatcat
tcgatttattgtgacaatattccagattcatttaatataattgcaaaagatgaagagggt
atagcaatgggtattcaacataagcagttgcctataattgctgtgcaattccatccagaa
tcaatattaactgctgcaggtaattcaggaataaaattattaaataatgtttttgaggag
ttatttaatttttacacagtaaaataa

KEGG   Clostridium pasteurianum BC1: Clopa_3493Help
Entry
Clopa_3493        CDS       T02645                                 

Definition
(GenBank) glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01130  Biosynthesis of antibiotics
cpas01230  Biosynthesis of amino acids
cpas02024  Quorum sensing
Module
cpas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_3493
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Clopa_3493
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Clopa_3493
Enzymes [BR:cpas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Clopa_3493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 DUF3383
Motif
Other DBs
NCBI-ProteinID: AGK98283
UniProt: R4K6U5
LinkDB All DBs
Position
complement(3484603..3485262)
Genome map
AA seq 219 aa AA seqDB search
MILIIDNYDSFTYNLYQYVGEILTSRENMGKIAPLEKFTPMGCEVKVVRNDKIKVEDIEN
MDLDGIILSPGPGTPEKAGICVDVIKKYAGKIPILGICLGHQAIGYAYGGNIVRAENIKH
GKTSDIKHNGEGMFKGINNPLKVMRYHSLVVDKDTFPKELTITAESMDDGVVMALKHNKY
DIYGLQFHPESIITEQGKTMIKNFVEGICNVKGSNKENK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatacttataatagataattatgattcttttacttataatttatatcaatatgtagga
gagatacttacatctcgggaaaatatgggaaaaattgcacctttggaaaaatttacaccc
atggggtgtgaagttaaggttgtaagaaatgataaaattaaagttgaggatatagagaat
atggatttagatggaataatactttcgcctggaccaggtactccggaaaaagctggaatt
tgtgtggatgtaataaaaaagtatgctggtaaaataccaattttagggatttgtctcgga
catcaagctataggatatgcctatggaggaaatatagtgagagcagaaaacataaagcat
ggtaaaacttctgatataaaacacaatggtgaaggaatgtttaagggaataaataatcct
cttaaggttatgcgttatcattctttggtggtggataaggacacttttccaaaagagctt
actattacggcagaaagcatggatgatggagttgttatggcgcttaaacataataaatat
gatatttatggattgcaatttcatccagaatcaataattacggaacagggaaaaactatg
attaaaaattttgtggaggggatatgtaatgttaaaggaagcaataaagaaaataagtaa

KEGG   Clostridium pasteurianum BC1: Clopa_3494Help
Entry
Clopa_3494        CDS       T02645                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01130  Biosynthesis of antibiotics
cpas01230  Biosynthesis of amino acids
cpas02024  Quorum sensing
Module
cpas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_3494
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Clopa_3494
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Clopa_3494
Enzymes [BR:cpas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Clopa_3494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AGK98284
UniProt: R4KCL8
LinkDB All DBs
Position
complement(3485264..3486694)
Genome map
AA seq 476 aa AA seqDB search
MFNLNEKEFYEQRKLDKTFPITLKFNGDELTPIALYYNLKGRKKFLLESVYSEKEIGRYS
FMGVDPYMTIKSYKDEITISKAGSIEVVHGKVLDYVKQYVNIDYNSEVFNIPFTGGAIGY
VGYDVVRQYEKLPDNNIDELKVPEANLMFYKIFICYDHFKHDISVVYNVFPEDNSDYNKI
AETLDNVKQSIISGNVLHPLQEVNLNKEFESNVTEEEYCEIVEKAKGYIRAGDIFQVVPS
QRLKFKNSSEPFDVYRRLRSKNPSPYLFYIDFEDFQIAGSSPESLVSVKDNRVITNPIAG
TRPRGKSAEEDERLRKELLEDEKEKAEHLMLVDLGRNDIGRISEFGTVNVDRFMEIDFYS
HVMHIVSMVSGELKRELNCFDALSSCLPVGTVSGAPKVRAMEIIDELENVRRGIYAGAVG
YFSHNGNMDTCIAIRTIVFKDDYAYVQSGAGIVYDSDPKTEYRETLNKAMAMKEVI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatttaaatgaaaaggaattttatgaacagagaaaactagataaaacctttcct
attactcttaaatttaatggcgatgagttaactccaatagccttatattataatctaaag
ggaagaaaaaaattccttcttgaaagtgtttattctgagaaagaaatagggagatactct
tttatgggtgttgacccttacatgacaattaaaagttataaagatgaaattacaatatct
aaagctggtagtattgaagttgttcacgggaaagtgttggattatgtaaaacagtatgta
aatatagattataattccgaagttttcaatattccctttacaggaggggccatagggtac
gtgggttatgatgttgtaagacaatatgaaaaacttccagataataatatagatgaatta
aaagttcctgaagcaaacctcatgttctataaaatctttatatgttacgatcattttaaa
catgatataagtgttgtttacaatgtatttccagaggacaattctgactacaataaaata
gcagaaactcttgataatgtaaagcaaagcataatcagtggtaatgtattacatcctctt
caagaagtgaacttaaataaagaatttgaatccaatgttacagaggaagaatattgcgaa
attgtagaaaaggcaaagggatatataagagcaggggacatatttcaagttgttccatca
caaagactaaaatttaaaaattcatctgaaccatttgatgtatatagaagattgaggtct
aaaaatccatcgccgtatcttttttatatagattttgaagattttcagatagcaggatct
tccccagaaagtcttgtttctgtaaaagataatagagttataacaaatcctatagcagga
acaagaccaagaggtaagtcagcagaagaagatgagagacttagaaaggaacttttagaa
gatgagaaggaaaaagcagaacatttaatgcttgtggatctcggtagaaatgatattgga
aggataagtgaatttggtacagtaaatgtggatagatttatggaaatagatttttactcc
catgttatgcacatagtttccatggtatctggtgaattgaaaagagaattgaactgtttt
gatgctttaagttcctgcctgcctgtgggaacagtatcaggggctccaaaggtaagagcc
atggaaataatagatgaacttgaaaatgtgagaaggggaatctacgcaggggctgtagga
tatttttctcataatgggaatatggatacctgtatagctataaggactatagtttttaaa
gacgattatgcctacgttcaatctggtgcaggtatagtatatgattccgatcctaaaaca
gaatatagagaaactcttaacaaagccatggctatgaaagaggtgatttaa

DBGET integrated database retrieval system