KEGG   Clostridium pasteurianum BC1: Clopa_2089Help
Entry
Clopa_2089        CDS       T02645                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 Fibrillarin ADH_N_assoc NAD_binding_7 AlaDh_PNT_C NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AGK96971
UniProt: R4K5K1
LinkDB All DBs
Position
2103720..2104736
Genome map
AA seq 338 aa AA seqDB search
MKAAVFYGKHNIKVEEREYREIKENEILVKVKACGVCGTDIHIFNGEEGSAPVTPPIILG
HEYSGEVVKVGNNVEDIKIGDKVVIDPNIYCGECDYCRNGKKQLCENLTALGVNIDGGFS
EYCVVPKEQAYVFNNITFEEAAMVEPTACCLHGINNIGIKPGDKVLVLGAGAIGLIMLQL
AKISGASTVGVSEPIEKRRDTALELGADYILNPMEESFKNNLNKYLGKGPDVIIECTGNK
YVIESAFDIAKKGTKILLFAVSNPDIKVEISPFEIFKKELTIKGSLINPDTHLSALDLIS
SGKVNVQPIITHKFDLDKIEEALEMQKSVESVKVLIIP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtattttatggtaagcataatataaaagtagaggaaagagaatataga
gagataaaggaaaatgaaatattagttaaagttaaagcttgcggagtttgtggtacagat
attcatatttttaatggtgaagaaggttcagcgccagtaacaccgcctataatattaggt
cacgaatattcaggagaagttgttaaagtagggaataacgttgaagatataaaaataggt
gataaagtagttattgatcccaatatatattgtggtgaatgtgattattgcagaaatggt
aagaagcaattatgcgagaatttaacagctctaggtgtaaatatagatggaggttttagt
gaatattgtgtagttcctaaagagcaagcctatgtatttaataatataacctttgaagaa
gcagctatggtagagccaacagcttgttgtttacatggaataaataacattggaataaag
ccaggagataaagtattagtattaggagcaggagctataggcttaattatgcttcaattg
gcaaagatatcaggagcaagtacagttggagtaagtgaaccaatagaaaagagaagagat
acagctttagaactaggagctgattatatattgaatccaatggaagaaagtttcaaaaat
aatttaaataaatatcttggaaaaggtccagatgtaattattgaatgcacaggaaacaaa
tatgtaatagaaagtgcatttgatattgcaaaaaaaggaactaaaatacttttgtttgca
gtaagtaatccagatataaaagtagaaataagtccatttgaaatatttaaaaaggaacta
acaataaaaggttctctaataaatccagatactcatttgtctgctttagatttaatatct
agtggaaaggttaatgtacaaccaataattacccataagtttgatttagataagattgaa
gaagctttagagatgcaaaaaagtgttgaaagtgtaaaggtattaattataccttag

DBGET integrated database retrieval system