KEGG   Clostridium pasteurianum BC1: Clopa_2141Help
Entry
Clopa_2141        CDS       T02645                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGK97019
UniProt: R4K934
LinkDB All DBs
Position
complement(2152652..2154151)
Genome map
AA seq 499 aa AA seqDB search
MVLKENKDIENVVDSAYKLYIDGKWIDSTENNTIKSYNPANGKFLAEFVDATNDDVDKAV
NAAWKAFHEWKTVSREERSRLLLKIADLIEENAEHLALVETLDNGKPLRETLNVDVPASA
DHFRYFAAAIRTEEGTAQDIDKNTLSIVLKEPIGVVGQVIPWNFPILMAAWKIAPALAAG
DTIVIHPSSSTSLSLLELVKLIGNILPAGVLNLITGKGSKSGDYMLKHQGFSKLAFTGST
EIGYEVAKEAANKLIPATLELGGKSANIFFDDAPFEKAIEGAQLGILFNQGQVCCAGSRL
FVQEGIYDKFLSALKEAFEKVKVGLPWDIETQMGAQVNHGQLEKILNYVEIGKEEGATLI
TGGYKINEGELDSGEFIKPTLIADAKNDMRIAQEEIFGPVATVIKFKDEEEVIKLANDSE
YGLGGAVWTTNINKALRVAKAVETGRMWVNTYNQLPAGAPFGGYKKSGIGRETYKSILGA
YTQTKNIFINISDDKLGLY
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtattaaaagaaaataaagatattgaaaatgtagttgacagcgcttacaaactatat
atagacggtaaatggattgatagcactgaaaataatacaataaagagctataatcctgca
aacggcaaatttttagctgaatttgtggatgcaactaatgatgatgtagataaagctgta
aatgcagcttggaaagcttttcatgaatggaaaacagtaagccgtgaggaaagaagcagg
cttctcctaaaaattgctgatttaattgaagaaaatgcagaacatctagctttagtagaa
accctggataacggtaaaccattgagagaaactcttaatgttgatgtgccagccagtgca
gatcattttagatattttgcagcagccataagaactgaggaaggaaccgctcaggacatt
gataagaatacattgagcattgttttaaaggagcctattggtgttgttggccaggttatt
ccatggaattttccaatacttatggcagcctggaaaattgctcctgcactagcagctgga
gacactatagtcattcatccttcttcttctacttctttaagtcttctagaacttgtaaag
cttattggcaatatactcccagcaggtgtattgaatttgattactggaaagggttctaaa
tctggcgattatatgcttaaacaccaaggtttcagtaaacttgcctttacaggttctaca
gaaataggttatgaagtggcaaaggaagctgcaaataaacttataccagctactcttgaa
cttggcggtaagtctgcaaatattttctttgatgatgctccttttgaaaaggccattgaa
ggtgcacaattagggatactttttaatcaaggtcaggtttgctgtgcaggctctagatta
tttgttcaagaaggtatctatgataaatttctttccgctttaaaagaagcctttgaaaaa
gtaaaagtaggccttccatgggacattgaaactcaaatgggtgcacaagtaaatcacggc
caactggaaaaaatattaaactatgtagaaataggtaaagaagaaggtgcaacccttata
actggaggctataagattaatgaaggtgaactagattctggcgagttcattaaaccaaca
cttattgcagatgctaaaaatgacatgagaatagctcaggaggaaatcttcggacctgta
gccacagtaataaaatttaaggatgaagaagaagttattaaactggcaaatgactctgaa
tatggtcttggaggagcagtatggacaacaaatataaataaagctttaagagttgctaaa
gcagtggaaacaggtagaatgtgggttaatacttacaatcagttacctgctggtgctcct
ttcggtggatataaaaagtctggaataggaagagaaacctataaatcaattcttggtgcc
tatactcaaaccaaaaatatatttataaatatttcagatgataagcttggtttatattaa

DBGET integrated database retrieval system