KEGG   Clostridium pasteurianum BC1: Clopa_3488Help
Entry
Clopa_3488        CDS       T02645                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00260  Glycine, serine and threonine metabolism
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01230  Biosynthesis of amino acids
Module
cpas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clopa_3488
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_3488
Enzymes [BR:cpas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clopa_3488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AGK98278
UniProt: R4K6U0
LinkDB All DBs
Position
complement(3480080..3480877)
Genome map
AA seq 265 aa AA seqDB search
MNRIEAKFNELKDKNEKAMIPFVTAGDPDLETTIELVNAMEKAGADIIELGVPYSDPLAD
GPTIQASSQRSLKNGTTIAKIMDTVKKIRLSTEVPLVYLVYYNSVFNYGIERFIKDCNEV
GIDGVIIPDLPIEERKDILTLGDKYNVALIPLIAPTSKERIKNIVKNASGFIYCVSTNGV
TGARNEIKTDLNEYMSTVAQYAEIPKALGFGISSAKMAKELKAYCDGIIIGSAIVKKVAE
AKGKDETIKNVMDFVKEVKSVLKNN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattgaagctaaattcaatgaattaaaagataaaaatgaaaaggcaatgatt
ccctttgtaacagcgggagatcctgatcttgaaactactattgaactagtaaatgctatg
gaaaaggcaggagcagatattattgaacttggagttccctattctgatcctcttgcagat
ggacctacaattcaggcttcttctcaaagatcacttaaaaatggaacaactatagctaaa
ataatggatacggtaaaaaaaatacgtttaagtactgaagtgcctctagtttatctggta
tattataattcagtattcaattatggtattgagagatttataaaggattgtaatgaagtt
ggtatagatggtgttataatacctgatcttcctatagaggagagaaaagatatactaact
ttaggggataaatacaatgttgctcttataccattaatagcacctacatctaaagagaga
ataaaaaatatagttaaaaatgccagcggctttatatactgcgtatcaactaatggtgtt
acaggggctagaaatgaaataaagactgatttaaatgaatatatgagtactgtggctcaa
tatgcagagatacctaaggctttaggttttggtatttccagtgcaaaaatggcaaaggaa
ttaaaagcttactgtgatggaattataattggaagtgccattgtaaaaaaggtagctgaa
gcaaaaggtaaagatgagacaatcaaaaatgttatggattttgtaaaagaagtgaaatca
gtacttaaaaacaattga

KEGG   Clostridium pasteurianum BC1: Clopa_3489Help
Entry
Clopa_3489        CDS       T02645                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00260  Glycine, serine and threonine metabolism
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01230  Biosynthesis of amino acids
Module
cpas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clopa_3489
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_3489
Enzymes [BR:cpas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clopa_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP LeuA_dimer
Motif
Other DBs
NCBI-ProteinID: AGK98279
UniProt: R4KCL3
LinkDB All DBs
Position
complement(3480877..3482052)
Genome map
AA seq 391 aa AA seqDB search
MIGRFGKFGGQYVPETIMNAVAELEVEYDKAKKDENFIKEFRYYLKDYVGRESPLYYAEN
LTKKFGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKRVIAETGAGQHGVATATIA
AMFGLECEIFMGEEDIRRQALNVFKMKILGAKVTAVTSGTGTLKDAVNETMRNWVTSVDD
TFYVVGTVMGPHPYPTMVRDFQRVIGDEAKEQILEKEGRLPDYIIACIGGGSNAMGIFYP
FAEDKEVKLIGVEAAGKGIDTDEHAASITKGSVGVIHGMMTYVLQDGDGQIIPAYSISAG
LDYPGVGPEHAYFNDIGRAEYVSANDKEAVDAFVEVSRVEGIIPALESSHALAYAMKFAP
TLDKDKIIIVNVSGRGDKDINTIAKVMGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgattggaagatttggaaaatttggagggcagtatgtgccagaaactataatgaatgca
gttgcagagttagaagtggaatatgataaagcaaagaaggatgaaaattttataaaagaa
tttaggtactatttaaaggactatgtgggaagagagtcacctctttactatgctgaaaat
ttaactaaaaaatttggaggagccaaaatttatcttaaaagagaagatcttaatcataca
ggagcacataagattaataatgctttaggtcaggttctacttgcaaagagaatgggtaaa
aagagggttattgcagaaacaggagcaggacagcatggtgtcgcaacagcaactatagca
gctatgtttggattagagtgtgaaatatttatgggagaggaggatataagaagacaagca
cttaacgtgtttaagatgaaaatactaggggcaaaggttactgcagttacttcaggcact
ggaactcttaaggatgctgtaaatgagactatgagaaattgggttacaagtgtagatgat
accttttatgttgtaggaacagttatggggcctcatccttatccaactatggttagagat
tttcaaagggttattggggatgaagctaaagaacaaatattggagaaagaaggaagatta
ccagactatattattgcatgtataggcggcggaagtaatgctatgggcatattctatcct
tttgcagaagacaaagaagttaaacttataggagtagaagcagctggaaagggaattgac
acagatgagcatgcagccagcataactaagggctctgtgggggttattcacggaatgatg
acttatgtacttcaagatggtgatggtcaaataattccagcttactccatatcagctggg
ctagattatcctggtgtaggaccagagcatgcatatttcaatgacataggaagagcagag
tatgtatctgccaatgacaaggaagcagtagatgcctttgtggaagtatcaagggtagaa
ggtataattcctgcactggaaagctctcatgctttggcctatgctatgaagtttgcacct
acacttgataaagataaaataatcattgtaaatgtatctggtagaggagataaggatata
aacactatagctaaggtaatgggggtagaactataa

DBGET integrated database retrieval system