KEGG   Clostridium pasteurianum BC1: Clopa_3490Help
Entry
Clopa_3490        CDS       T02645                                 

Definition
(GenBank) phosphoribosylanthranilate isomerase
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01130  Biosynthesis of antibiotics
cpas01230  Biosynthesis of amino acids
Module
cpas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_3490
Enzymes [BR:cpas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Clopa_3490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRAI
Motif
Other DBs
NCBI-ProteinID: AGK98280
UniProt: R4KF96
LinkDB All DBs
Position
complement(3482049..3482774)
Genome map
AA seq 241 aa AA seqDB search
MTKIKICGLKRLQDIEYVNELLPDYVGFVFAKSKRQVHMEKAEELISKLNTGIKTVGVFV
NEDIKKVKEIAENLKLDVLQFHGCEDKEYFLELDRFTLWKSVSIEAEISKDKAVSNYGKV
DLINNSEYHSNSKGAFYKYKIDEYQSNLDGINKYNIEAVVLDSSVKGTEGGTGISFDWNV
ISKLNIEKNLILAGGLNTDNVIEAINKVKPFAVDVSSGVETDGVKDFNKIKTFIEKVRNI
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactaagataaaaatatgtggattgaaaagattacaggatatagaatatgtaaatgaa
cttctgcctgattatgtaggtttcgtatttgctaaaagtaaaagacaggttcatatggaa
aaggctgaagagcttatatctaaattaaatactggcataaaaactgtaggagtctttgta
aatgaagatataaaaaaggtaaaggaaatagctgaaaacttaaaattagatgtgctgcaa
tttcatggttgtgaggataaggaatactttttagaattagatagatttactttgtggaaa
tccgtatctatagaagcagagataagcaaagataaggcagttagcaattatggaaaagtt
gatctaataaacaatagtgaatatcatagtaattctaaaggtgccttttataaatacaaa
atagatgaatatcaaagtaatttggatggaattaacaaatataatattgaagctgtagtt
ctggatagcagcgttaagggtacagaaggtggaacgggtattagttttgactggaatgtt
atttctaaacttaatattgagaaaaacttaatattagcaggtggattaaatacagataat
gtaattgaagccataaataaagttaaaccctttgctgttgatgtatccagtggagtagaa
acagatggggtaaaggattttaataaaataaaaacatttatagagaaagtgaggaatatt
aaatga

DBGET integrated database retrieval system