KEGG   Clostridium pasteurianum BC1: Clopa_3492Help
Entry
Clopa_3492        CDS       T02645                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01130  Biosynthesis of antibiotics
cpas01230  Biosynthesis of amino acids
Module
cpas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_3492
Enzymes [BR:cpas01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Clopa_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AGK98282
UniProt: R4K543
LinkDB All DBs
Position
complement(3483621..3484634)
Genome map
AA seq 337 aa AA seqDB search
MLKEAIKKISNKDNLNEEEAYSSVNEIMKGEALPSQIGAFLVGLRMKGETVEEITGAARA
MRDNASVVKLESEYVIDTCGTGGDGSKTFNISTAVAIIAAAAGVKVAKHGNRAVSSSSGS
ADVLQELGINIDVEPEKAKKLIDEKGMAFLFAQKYHSAMKNVGPVRKELGIRTVFNILGP
LTNPAFVKGQVLGVYSKELTHTLAEVLLKLGSEKAMVVHGEDGLDEITTTTTTYVSEIRE
GKVVDYIIEPEKLGIPLAKVEDIKGSSAKENAGIIIDILKGKSGAKRDIVVLNTAAALYV
GKVAENLEQGIKLTEDIIDSGKAYKKLNELVEYSKEV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaggaagcaataaagaaaataagtaataaagataacttaaatgaggaggaagct
tattcttctgtaaatgaaatcatgaagggggaagcgcttccatcacaaataggagcattt
ttagtaggacttagaatgaaaggggaaaccgttgaagaaataactggagctgcaagagct
atgagagataatgcttctgttgttaaattggagtctgaatatgttatagatacctgtgga
actggtggagatggaagcaaaacctttaatatctctacagcagtggcaataattgcagct
gcagcaggagttaaggtggctaagcatggcaatagagcggtttccagcagcagcggcagt
gctgacgtacttcaggaacttggcattaacatagatgtagaacctgaaaaggcaaaaaaa
ttaattgatgaaaagggaatggcatttttgtttgctcagaaatatcattcagctatgaaa
aatgtgggacctgtaagaaaagaacttggaataagaactgtattcaatatactgggacca
cttacaaatccagcctttgtaaagggtcaggtactgggcgtttatagcaaggaattaact
catactcttgcagaggtgcttttgaaattaggtagtgaaaaggctatggtagttcatggt
gaagatggattagatgaaattacaactactacaactacttatgtaagcgagattagagag
ggtaaggttgttgattatattattgaacctgaaaagcttggtataccattagcaaaggtg
gaagatattaagggctcttcagctaaagagaatgctggtataataatagatatattgaaa
ggaaaaagtggagctaaaagagatatagtagttttaaataccgcagcagcactgtatgta
ggaaaagttgcagaaaacttggaacaaggtataaaactcactgaagatattatcgattca
ggtaaagcatataaaaaattaaatgaacttgtagaatacagtaaagaggtgtaa

DBGET integrated database retrieval system