KEGG   Clostridium pasteurianum BC1: Clopa_3537Help
Entry
Clopa_3537        CDS       T02645                                 

Definition
(GenBank) phosphonate metabolim protein, transferase hexapeptide repeat family
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AGK98324
UniProt: R4KCQ6
LinkDB All DBs
Position
complement(3533885..3534514)
Genome map
AA seq 209 aa AA seqDB search
MNTEEKVLTIEPLIGENCKIVNSKLGEFTEVGVFNFYENVVLGDYSYTGQFCFLQNVEIG
RFTNIAAMVRIGPTNHPMERPSLHHFTYRRKMYGFDDKDDEEFFEKRKSSKTYIENDAWI
GHSAIIMPGVTIGNGAIVGSGAIVTKDVEPYTIVAGVPAKIIRKRFNDDIIYKLESIKWW
NWSHKKIKENFNDFLLNIDDFVEKHYESR
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgaggaaaaagtactgacaatagaacctttaataggtgagaactgtaaaatt
gtaaattcaaaactgggtgaatttacagaggttggggtttttaatttctatgaaaatgtt
gttcttggcgattactcctatacaggacaattttgttttctgcaaaacgttgaaataggc
agatttactaatattgctgccatggtgagaataggacctacaaatcatcctatggaaagg
cctagcttacatcattttacctatagaaggaagatgtatggttttgatgataaagatgat
gaagaattttttgaaaagagaaaaagtagtaaaacatatattgaaaatgatgcttggata
ggtcacagtgcaattattatgcctggtgtaaccataggaaatggagctatagttggaagt
ggagctatagtgacaaaagatgtggagccctataccatagttgcaggtgtaccagcaaaa
ataattagaaagaggtttaatgatgatatcatttataaattggaaagcattaaatggtgg
aattggtctcataaaaagataaaggaaaatttcaatgattttttattgaatatagatgac
tttgtggaaaagcattatgaaagtaggtga

DBGET integrated database retrieval system