KEGG   Clostridium pasteurianum BC1: Clopa_3553Help
Entry
Clopa_3553        CDS       T02645                                 

Definition
(GenBank) putative Zn peptidase
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M78 Peptidase_U49 Peptidase_M48 Peptidase_M41 Peptidase_M56 NIBRIN_BRCT_II
Motif
Other DBs
NCBI-ProteinID: AGK98338
UniProt: R4K6Z6
LinkDB All DBs
Position
3547393..3547830
Genome map
AA seq 145 aa AA seqDB search
MIKDIVQGVIDLYMTRDPFELCNCLDIESMLNDLGDEIKGFFQRTPDGYEIIHINTRLSE
EERRYICAHELGHAILHTNMSIGFFIENKLQIRNKYEIEADRFAAELLIEDNLDSKEFSQ
LNVEQISRCLCVPEKLIIYKFNLDI
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagatattgtccaaggtgttattgatttatatatgactagagatccctttgaa
ttatgtaattgcttagatattgaaagcatgcttaatgatttgggagatgaaataaagggc
ttctttcaaagaactcctgacggttatgaaataattcatataaacacaagattatctgaa
gaagaaagaagatatatttgtgctcatgagttaggccatgctattctccatacaaatatg
tctataggcttttttattgaaaacaaacttcaaattagaaataaatacgaaattgaagca
gatagatttgcagctgagctattaatagaggacaaccttgattctaaagagttttcccag
ttaaatgttgaacaaattagcaggtgtttatgtgtacctgaaaaacttattatatataaa
tttaatttggatatataa

DBGET integrated database retrieval system