KEGG   Clostridium pasteurianum BC1: Clopa_3579Help
Entry
Clopa_3579        CDS       T02645                                 

Definition
(GenBank) hypothetical protein
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0052
Motif
Other DBs
NCBI-ProteinID: AGK98361
UniProt: R4K9I9
LinkDB All DBs
Position
complement(3573240..3574586)
Genome map
AA seq 448 aa AA seqDB search
MKIIDWIRPGIKVKRWVMLGIMGIMLITFGLAEIINKSRFYSYEYSAYYIFLVISGAFIL
YMSVTQGMKSIIALINKGYLNVSLDSRKLGNLIYEKRLLVKGPKIVAIGGGTGLSTMLRG
LKYYTSNITAIVTVADDGGGSGDLREDLGMLPPGDIRNCILALSDTEPLMEELLQYRFKD
GRLKNQSFGNLFLAAMDGLSSNFEEAVRKMSSVLAVTGRVVPVTLENVTLRAELKNGVIV
EGESNIPEAVKQYESAIERIFINPEDVRALKEAIEAITEADAIILGPGSLYTSVIPNLLV
KDISSALQKTKALKLYVSNIMTQPGETDGYSVSDHIKAIYKHGGEGIVDYTVINTEKIDE
VLQDKYLEKTSELVNIDEDILKKMGVGTVKGNFIKIKNGYVRHDSDRLADILVETIMDKK
LFYDRKKIIEYFYLSERLKENKASEKKK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaagataatagattggattagaccaggtattaaggtcaaaagatgggtaatgcttgga
atcatgggcattatgcttattacctttggtttagctgaaattatcaataaaagcagattc
tacagctatgaatattcggcatattatatatttttagtaataagcggggcttttatactt
tatatgtcagtgactcagggaatgaaatctattattgccttaataaacaaaggatattta
aatgtatctttagattccagaaaactcgggaatctcatatatgaaaaaagattacttgta
aaaggacctaaaattgttgctattggtggaggaacagggctttctaccatgcttagaggt
ttaaaatattatacctccaatataactgctattgttacagtggcagatgatggtggcgga
tctggagatttaagagaagatcttggtatgcttccaccaggggatataagaaactgcatt
ttagccttatcagacaccgaacctttaatggaagaacttttacaatataggtttaaagat
ggtagacttaaaaaccaaagctttggtaatttatttcttgcagctatggacggattgtca
agtaattttgaagaggcagtaagaaaaatgagctctgttttggcagtaactggtagggtg
gtacctgtaaccttagaaaatgtaactttaagggcagaactaaaaaatggtgttatagtg
gagggtgaatcaaatataccggaagctgtaaagcaatatgaaagtgctattgagagaata
tttataaaccctgaagatgtaagagcattaaaggaggcaattgaagcaataacagaggct
gatgcaataatactggggccaggaagcctttataccagtgtaattccaaatcttttggtg
aaggatatatcttctgcacttcaaaaaacaaaagctttgaagctatatgtttctaatata
atgacccaaccgggggaaacagatggatattctgtttctgatcatataaaagccatatac
aagcatggaggagaaggtatagtagattatacggttattaatactgaaaaaatagatgaa
gtacttcaggataaatatcttgaaaagacttcagaattagttaatattgatgaagatata
ttaaaaaaaatgggagtagggacagtaaaaggtaattttataaagattaaaaatggatat
gttagacatgattcagatagattagcggatatattggttgaaacaattatggataaaaaa
ttattttatgatagaaagaaaattattgaatatttctatttatctgagaggttgaaagaa
aataaagcatctgaaaagaaaaaataa

DBGET integrated database retrieval system