KEGG   Clostridium pasteurianum BC1: Clopa_3594Help
Entry
Clopa_3594        CDS       T02645                                 

Definition
(GenBank) hypothetical protein
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YitT_membrane DUF2179 DUF1514
Motif
Other DBs
NCBI-ProteinID: AGK98376
UniProt: R4K9K7
LinkDB All DBs
Position
complement(3593869..3594810)
Genome map
AA seq 313 aa AA seqDB search
MRHLKINNNIKVLTIYFLICLAINNDKGDEMKKLKEYVLITIGFLIVVLSIKFFLEPNKI
AAGGIMGIAIIVNEIFPKLSVGLLMTVMNSALFIVAFSAIGGKFGAKTIYSSLGLSGAVW
IMDKFFTFGTITNNILLATLFGTLLSGIGMGIVFNQNASTGGTDIIAKILNKFFHIDIGK
ALLIVDLIITLFAGATLGADLGMFSLLSVILHGFIIDMVIEGFNVCKQIMIISKKNDEIS
KYIIEKLDRGCTVFNGKGGYTWEDTFILYTVLSRNEFIKLKKYIKEIDPKAFITVSDARE
VLGEGFNNIVGED
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagacatctgaaaataaataacaatattaaagtactaaccatttattttttaatatgc
ctagcaataaataacgataagggtgatgaaatgaaaaaattaaaagaatatgtattaata
actattggatttttaattgttgttctcagtataaagttttttttagaaccaaacaaaata
gcagcaggtggaattatgggaatagcaataatagttaatgaaattttccctaaactgtct
gtagggcttttgatgactgtgatgaattcagctttgtttatagtagcttttagtgctata
ggaggaaagtttggggctaagaccatatattcaagcttagggctttcaggtgcagtttgg
attatggataaatttttcacttttggaactataactaacaatatattgcttgcaacctta
tttggaactcttttaagtggtataggaatggggatagtttttaatcagaatgcatctact
gggggaactgatattattgcaaagattttaaataagttttttcacattgatattggtaaa
gctttactaattgtagatcttattataacactttttgcaggtgctactcttggtgctgat
cttggtatgttttcattgctgtctgttatactccatggctttataatagatatggtaatt
gaaggttttaatgtatgtaaacaaataatgataataagtaaaaaaaatgatgagataagt
aaatatattatagaaaaacttgatagaggttgtactgtgttcaatggtaaaggtgggtat
acctgggaagatacctttatactatacacagtacttagcagaaatgaatttataaaatta
aaaaaatacataaaggaaattgatccaaaagcatttataactgtaagtgatgcacgtgaa
gttctaggagaaggatttaataacatagtaggtgaagattaa

DBGET integrated database retrieval system