KEGG   Clostridium pasteurianum BC1: Clopa_3607Help
Entry
Clopa_3607        CDS       T02645                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00473  D-Alanine metabolism
cpas01100  Metabolic pathways
cpas01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Clopa_3607
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Clopa_3607
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cpas01011]
    Clopa_3607
Enzymes [BR:cpas01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Clopa_3607
Peptidoglycan biosynthesis and degradation proteins [BR:cpas01011]
 Precursor biosynthesis
  Racemase
   Clopa_3607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PX
Motif
Other DBs
NCBI-ProteinID: AGK98389
UniProt: R4KCV8
LinkDB All DBs
Position
complement(3608779..3609939)
Genome map
AA seq 386 aa AA seqDB search
MFKHLRPVWAEINLDNLEFNMKGIKKLAKSTEIFGVVKADAYGHGAIDVAPVLLENGATR
LAVAVISEAVELRRAGIDCPIMILGYTPLSLADDILKYDIEQTVFSYEYALELSKVAEKR
HIKVKIHIALDTGMGRIGFLPDEKSVEDVYKIGELPNIEIEGLFSHFSTADEDNKDYTYK
QYNNFNWFYEKLKDRGVSIMVRHVANSAAIMDLPDTHLDGVRPGIILYGYYPSEEVNKKK
LELKPVMTLKTNIVHIKTLKKGEYISYGRKFRCEKDSVIATLPVGYADGYTRLMFGKAKV
IINDEFAPVVGRICMDQCMVDITDISTAKVGDEVILMGESKNCKFNADDIAEHINTINYE
VVCMIGKRVPRVYIKNRKVTKIRNYV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaacatttaagacctgtttgggcagaaattaatcttgataatttggaatttaat
atgaagggtataaaaaaacttgctaaaagcaccgaaatctttggcgtagtaaaggccgat
gcctatggacatggagccattgatgtagcacctgtacttttagaaaatggtgctactagg
ttagctgtagcagttataagtgaagctgtagaacttagaagagctggaattgactgccca
attatgattttgggatatacacctttgagtttagctgatgatatattgaaatacgatata
gaacaaactgtattttcctatgaatatgcattagaactttctaaagtggctgaaaagaga
cacataaaagttaaaatacatatagcattggatacagggatggggagaattggattttta
cctgatgagaaaagcgtagaagacgtatataaaataggcgaattgccaaatatagaaata
gaaggattattttctcatttttctacggcagatgaagataataaagactatacgtacaag
caatataataattttaattggttttatgaaaaactcaaagatagaggtgtttcaataatg
gtaaggcatgtagctaatagtgctgctatcatggatttaccggatacccatcttgatgga
gtaaggcctggaataatactctatggatattatccctctgaggaagtaaataagaaaaag
ttagaattaaaacctgtaatgactttaaaaaccaatatagtacacataaaaactcttaaa
aaaggggaatatataagttatggcagaaaattcagatgtgaaaaagacagtgttattgcc
actcttcctgtagggtatgctgatggatatacaagacttatgtttggaaaggcaaaagtt
ataataaatgatgaatttgctcctgtagttggtagaatctgcatggatcaatgtatggta
gacataactgatattagtacagccaaggttggagatgaagtaatccttatgggagagtct
aaaaattgtaagtttaatgcagatgatatagctgaacatataaatactataaattacgaa
gtggtttgtatgattggaaaaagagttcctagagtctacataaaaaatagaaaagttaca
aaaataaggaactatgtgtag

DBGET integrated database retrieval system