KEGG   Clostridium pasteurianum BC1: Clopa_3608Help
Entry
Clopa_3608        CDS       T02645                                 

Definition
(GenBank) hypothetical protein
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3928 DUF4969
Motif
Other DBs
NCBI-ProteinID: AGK98390
UniProt: R4KFK3
LinkDB All DBs
Position
complement(3609974..3610579)
Genome map
AA seq 201 aa AA seqDB search
MKKILLICTFFVFIISVTGCGSKNKGEKDTLVYLKNLKSYSADMNIEVKNDKQKLNYSGR
QIYSLGLGYRLELNKERVLIYREDKIYVTDLQNGQKYTTDMSFDDVYKLSFLGNFIDLLY
TNESIKTSFETIDNDQYELVNTDMPDSNRNIGYGVLYIEVDKKLPEKLIIYDKNGKEKFI
ITYKNFIPNCNVDKTLFEFNQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatattattaatatgtacattctttgtttttattatatctgtaactggatgt
gggtctaaaaataagggagagaaagatactttagtatatttaaaaaatttaaaaagctat
agtgcagatatgaatattgaagttaaaaatgataaacaaaagttgaattacagtggtaga
caaatatattctttagggttaggatatagattagagctaaataaggaaagagtgcttata
tacagggaagataaaatttatgttactgatttacaaaatggacaaaaatatacaactgat
atgagttttgatgatgtatataaactaagttttttaggaaattttattgatctgctatat
acaaatgaaagtataaaaacttcttttgaaactatagataatgatcaatatgaattagtg
aatactgatatgcctgatagcaataggaatataggctatggtgttctatatattgaggtg
gataagaagcttcctgaaaagttaattatatacgataaaaatggaaaagaaaaatttata
ataacgtataaaaattttatacctaactgtaatgtagataaaactctttttgagtttaat
caataa

DBGET integrated database retrieval system