KEGG   Clostridium pasteurianum BC1: Clopa_3614Help
Entry
Clopa_3614        CDS       T02645                                 

Definition
(GenBank) hypothetical protein
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGK98396
UniProt: R4K9M9
LinkDB All DBs
Position
3615502..3615654
Genome map
AA seq 50 aa AA seqDB search
MVRKEKTATNNQWASIPEESPEKINSSHKQEKTATDNQWTSTIKNHVNEK
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atggtaaggaaagaaaaaacagctactaataatcagtgggcatcaattcctgaagagtca
ccagaaaaaataaattcttctcataaacaagaaaaaacagctactgacaatcaatggaca
tcaactataaaaaatcatgttaatgaaaaataa

DBGET integrated database retrieval system