KEGG   Clostridium pasteurianum BC1: Clopa_3986Help
Entry
Clopa_3986        CDS       T02645                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_3986
Enzymes [BR:cpas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Clopa_3986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT ACT_4
Motif
Other DBs
NCBI-ProteinID: AGK98731
UniProt: R4KAJ8
LinkDB All DBs
Position
complement(4021323..4022180)
Genome map
AA seq 285 aa AA seqDB search
MRKIATLGPAGTFCEIAAKKYNNEKDFNGNIIFYSSITKAFKAIGEECNLGVIPIENALD
GYVQPALELLAKTELKIIDEIIIPIQFSFVANSKNISDVEKIYVQFKTQGQCCDFLEQFD
SNVKIITTESNGESFVNAKYGNIHEAAIVPQHMLRSGFKLPYEIENVTDSKENETRFIVV
SEKTQNYSQSEGKNYKTSLIITQTEDKPGSLANILNEFSSRGINLMSILSHPNKQALGKY
YFFIDVDGNYLEDKDLNEAIKNISVNNKVKIFGTYENAIKNSKDN
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatagccactcttggaccagcaggaactttttgtgaaattgcagctaaaaaa
tacaataatgaaaaagattttaatggaaatataattttttattcaagtataacaaaagct
tttaaggccattggagaagaatgtaatttaggggtgatacccattgaaaatgcgctggat
ggttatgttcagccagcgcttgaactcttagcaaaaacagagttaaaaataatagatgaa
attattattccaattcaattttcttttgtagcaaattcaaaaaatatttctgatgtagaa
aagatatatgttcaatttaaaacccaaggtcaatgctgtgattttttagaacagtttgat
agcaatgtaaaaattataaccactgaaagtaatggagaatcttttgttaatgcaaagtat
ggcaatattcatgaggcagctatagtacctcagcacatgctaagaagtggctttaaattg
ccctatgaaattgaaaatgtaactgattctaaggaaaatgagacaagattcatagttgtt
tctgaaaaaactcaaaattattctcaatctgaaggaaaaaactataaaacttctttaatt
attacccaaactgaagacaaaccaggctcactggctaatatattaaatgaattttcttct
aggggcattaatttgatgtctatattatcacaccctaataaacaggcactgggaaaatat
tatttttttattgatgtagatggtaattatttagaagataaagatttaaatgaagctatt
aagaatatttctgtaaataataaagtgaagatatttggtacttatgaaaatgcaataaaa
aatagcaaagataattaa

DBGET integrated database retrieval system