KEGG   Clostridium pasteurianum BC1: Clopa_4046Help
Entry
Clopa_4046        CDS       T02645                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphohydrolase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00340  Histidine metabolism
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01230  Biosynthesis of amino acids
Module
cpas_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Clopa_4046
Enzymes [BR:cpas01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Clopa_4046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG MazG-like
Motif
Other DBs
NCBI-ProteinID: AGK98786
UniProt: R4KAR2
LinkDB All DBs
Position
complement(4093695..4094021)
Genome map
AA seq 108 aa AA seqDB search
MKEIIEELYATIINRKANPIKDSYTNYLFEKGIDKILKKVGEESTETIIAAKNNNPEELV
METCDLIYHLMVLLANQGINLKDIEAELIKREAKTGNKKPERREIENL
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaattattgaagaactttatgccactattataaatagaaaagctaatccaata
aaagattcctatacaaattatctatttgaaaagggaatagacaagatacttaaaaaagtg
ggagaagaaagtactgaaacaataatagcagcaaaaaataataatcctgaagaacttgta
atggaaacctgtgatttaatctatcatttgatggttctgttggcaaatcaaggaataaat
ttaaaagatattgaagctgaattaattaaaagagaggctaaaacaggaaataaaaagcct
gagagaagagaaatagaaaatctgtaa

DBGET integrated database retrieval system