KEGG   Clostridium pasteurianum BC1: Clopa_4660Help
Entry
Clopa_4660        CDS       T02645                                 

Definition
(GenBank) monofunctional chorismate mutase, clade 2
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01130  Biosynthesis of antibiotics
cpas01230  Biosynthesis of amino acids
Module
cpas_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_4660
Enzymes [BR:cpas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     Clopa_4660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N CM_2 Shikimate_DH F420_oxidored Sacchrp_dh_NADP SDH_C PglD_N RNase_Zc3h12a 2-Hacid_dh_C NAD_binding_7 IlvN KR
Motif
Other DBs
NCBI-ProteinID: AGK99349
UniProt: R4KFM1
LinkDB All DBs
Position
complement(4720594..4721757)
Genome map
AA seq 387 aa AA seqDB search
MKDLEELREEIDTIDKQLVALFEKRMEAVLDVAKYKIKNSIPILNAEREKQVIEKNIRIL
KNKEFSNAVEDFFKSVMSISRNLEAHNMPDDKNIGKQSNIENFEPKIEDNVKIEADKTQT
KSTLFGLIGEKLGHSISPAIHSKLYKILGMNAVYELFEIEKKKLEVNFKALIANGVKGLN
VTIPYKVDIIKYLDEISVEADKIGAVNTICFKNGKVIGHNTDYHGFGKMLEKNNIPVKNK
KIVVLGAGGAAKAVIQYFIDNNAKDILLVSRDKKKAAENFKGTKIIDYDELKALEQGDVI
VNCTPCGMYPKTEISPVDENCIGKFSSAVDLIYNPKETLFLKYAKEKGIKAVNGLYMLVG
QAIAAEELWNDSTIDENIVDKIYQELL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagatttagaagaacttcgtgaagaaattgatactatagataaacaactggtggct
ctttttgaaaagaggatggaagctgttttagatgtagcgaaatataaaattaaaaattct
ataccaattttaaatgctgaaagagaaaaacaggttatagaaaaaaatataagaatttta
aaaaataaagaatttagtaatgctgtagaagatttttttaagtcagtaatgtctataagt
aggaatcttgaagcacataatatgcctgatgataagaatataggaaaacaaagtaacata
gaaaattttgaacctaagattgaggataatgtaaagattgaagctgacaaaactcaaact
aaaagtaccttatttggacttataggagaaaaattagggcacagcatatctccagctata
cattcaaagctttataaaatattgggaatgaacgctgtttatgaattatttgaaatagaa
aagaaaaaactggaagtaaatttcaaagctttaatagcaaatggagtaaagggtttgaat
gttactataccctataaagtggatattataaaatatttagatgaaatatccgtggaagca
gataaaataggagctgttaatactatatgctttaaaaatggcaaagttattgggcataat
acagattatcatggttttggcaaaatgcttgaaaaaaataatataccagtaaaaaataaa
aaaattgtagttttaggtgctggcggtgctgcaaaggcagttatacaatattttatagac
aacaatgctaaagatatactactggtaagtcgagataaaaaaaaggcagcagaaaacttt
aagggtacaaaaataattgattatgatgaacttaaagcgttggaacaaggtgatgtaatt
gtaaattgtacaccttgtggaatgtatcccaaaacagaaatttctcctgtagatgagaat
tgcataggtaaattttcttcagctgttgatttaatatataatccaaaggaaactttattt
ttaaagtatgctaaagaaaaggggataaaagcagttaatgggctatatatgctggttggg
caagccatagctgctgaggaactgtggaatgatagtactattgatgaaaatatagtggat
aaaatataccaagaacttttataa

DBGET integrated database retrieval system