KEGG   Clostridium pasteurianum BC1: Clopa_4662Help
Entry
Clopa_4662        CDS       T02645                                 

Definition
(GenBank) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01130  Biosynthesis of antibiotics
cpas01230  Biosynthesis of amino acids
Module
cpas_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_4662
Enzymes [BR:cpas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     Clopa_4662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AGK99351
UniProt: R4KCD8
LinkDB All DBs
Position
complement(4723228..4724520)
Genome map
AA seq 430 aa AA seqDB search
MNYVKITPSKLKGKVTIPPSKSLSHRAIIAAGLSKGKSVVENVMFSEDILTTCNAMEALG
VTIEKKEEENNIYTLIIDGSTELKLLKKEIDCSESGSSLRFFIPICLAEENDVVFTGRGK
LVSRPLNQYYEIFDKQGIKYSNENGKLPLKVQGKIQSGEFTIDGDVSSQFITGLMFTLPL
LQGDSKIIINKKLESKGYLDLTMDILNRFSVEVINKDYKEFLIKGNQQYKSMDYRVEGDF
SQAAFWLVAGMIGGEIDCLDLNPDSKQGDKEVLDIIKRMNGALNITSDKIYAETTNTSST
VIDASQCPDIIPVLAVLAALSEGTTEVINAGRLRIKESDRLTAITTELNKLGADLEEKED
GLIIRGKKELTGGEVDSWNDHRIAMALAVASIRCKDEVTIKDSGCVKKSYPTFWEDFKKL
GGNVHEWSVG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgttaagataactccatcaaaattaaaaggcaaggtaacaattccaccatct
aagagcttaagtcatagagctataattgcagcaggactttctaaaggtaagagtgtagta
gaaaacgttatgttttcagaggatatattaactacttgtaatgctatggaggcactaggt
gtaactatagaaaaaaaagaagaagaaaataatatttatactttgataatagatggaagt
actgagttaaaattattgaagaaagaaatagactgttcagaatcgggttcatctctaaga
ttttttatacctatatgtttagctgaagaaaatgatgttgtatttacaggaagggggaaa
ttagtttcccgtcctctgaatcagtattatgaaatttttgataaacaaggtataaagtat
tccaatgaaaatggaaagcttcccttgaaggtacagggtaaaattcagtctggagaattt
actatagacggagatgtaagctctcagtttataacgggacttatgtttactttgccatta
cttcagggtgattctaaaattataattaataagaagcttgaatcaaagggatatttggat
ctaactatggacatattaaatagattttcggtagaagtaataaataaggattataaagaa
tttttaataaagggaaatcagcaatataaaagtatggactatagagttgaaggggacttt
tcacaggcggccttttggcttgtggcaggtatgataggcggagaaatagattgtcttgat
ttaaatcctgactctaagcaaggtgacaaagaagtattagatataataaagagaatgaat
ggagcactaaacattactagtgataaaatatatgcagaaacaacaaatacaagttctaca
gttatagatgcatctcaatgtcctgatataataccggtactagcagttttagcggcttta
agcgaaggcactacagaggttattaatgcaggtagacttagaataaaagagtcagacaga
ttaactgccataactacagaattaaacaaattaggtgcagatttagaagaaaaagaagat
ggtcttataataagagggaaaaaagagcttacaggcggggaagtggacagctggaatgat
catagaattgccatggcccttgcagtagcttctataagatgtaaagatgaggttactata
aaagacagtggatgtgtaaaaaaatcttatcctaccttttgggaggactttaagaagcta
ggaggaaatgtccatgagtggagtgtggggtaa

DBGET integrated database retrieval system