KEGG   Clostridium pasteurianum BC1: Clopa_4665Help
Entry
Clopa_4665        CDS       T02645                                 

Definition
(GenBank) 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01130  Biosynthesis of antibiotics
cpas01230  Biosynthesis of amino acids
Module
cpas_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clopa_4665
Enzymes [BR:cpas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Clopa_4665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB PGM_PMM_II
Motif
Other DBs
NCBI-ProteinID: AGK99354
UniProt: R4KFM5
LinkDB All DBs
Position
complement(4726432..4727463)
Genome map
AA seq 343 aa AA seqDB search
MIIVMKPGVSKEKIEIFKERLEKRGLMVHVDFGDNYCILGLIGDTRAIDPEQIQAYEEVE
KVMIVQEPYKKANRLFHPEDSIININGRTIGGGKLAVIAGPCSVESEDQIVSIAEDVKEA
GAGFLRGGAFKPRTSPYSFQGMELEGLELLKIAREKTGLPIVTELMGTKMLERFVEDVDV
IQVGARNMQNFELLKELGKTNKPILLKRGLCATIEEWLMSAEYIMAGGNENVILCERGIR
TYETYTRNTLDLSAIPAIKKQSHLPVIVDPSHAAGMWWMVEPLSKAAVAVGADGLIIEVH
NDPANAKCDGQQSIKPNKFKSLMDSLKEIEKFKWSFNVDKLGI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgataattgttatgaaaccaggagtatcaaaagagaaaatagaaattttcaaagaaaga
ttagaaaaaaggggattaatggttcatgtggattttggcgataattactgtatactaggt
ttaataggagataccagagcaattgatccagagcagattcaggcatatgaagaggttgaa
aaagttatgattgttcaggaaccatataagaaagcaaatagattattccatcctgaagat
tctataataaatataaatggcagaactattgggggaggtaaattagctgttatagcagga
ccatgttctgttgaaagtgaagatcagattgtaagtatagcagaagatgttaaagaagca
ggagcaggatttttaagaggtggtgctttcaaacctagaacatcaccttacagtttccaa
ggtatggaactagaaggcttagaacttttaaaaattgccagagaaaaaacaggacttcca
atagtaacagaattaatgggaactaagatgcttgaaagatttgttgaagatgttgatgta
atacaggttggagctagaaacatgcagaacttcgagcttttaaaggaactgggaaaaact
aataagcctattcttttaaagagaggattatgtgctaccattgaagaatggcttatgtca
gcagaatatataatggctggtggaaatgaaaatgtaatactgtgtgaaagaggaataaga
acttatgagacttatactagaaatacgctagacttaagtgctataccggctataaagaaa
caaagtcatcttccagttatagttgatccaagtcatgcagcaggaatgtggtggatggta
gaacctctttcaaaagcagctgtagcagttggagcagatggattaataattgaggtacat
aatgatcctgctaatgctaaatgtgatggtcaacaatccataaaaccaaataaattcaag
tctctaatggactctttaaaggaaatagaaaaatttaaatggagctttaacgttgataag
cttggaatttaa

DBGET integrated database retrieval system