KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CLPA_c02630Help
Entry
CLPA_c02630       CDS       T03753                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cpat  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
cpat00240  Pyrimidine metabolism
cpat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CLPA_c02630 (tdk)
Enzymes [BR:cpat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CLPA_c02630 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK ATPase_2 AAA_14 UvrD-helicase IMPDH AAA_19
Motif
Other DBs
NCBI-ProteinID: AJA50351
UniProt: A0A0H3J374
LinkDB All DBs
Position
278246..278830
Genome map
AA seq 194 aa AA seqDB search
MYGPKNHGWIEVIVGPMYSGKSEELIRRIRRAKIAKQKVQVFKPEIDNRYSLDDVVSHCG
EKEEAISVKNSQEIVNFIEEDIDVLAIDEVQFFDENIIDILTKISDSGKRVICAGLDMDF
RGEPFGCVPKLMAIAEFVDKIQAICMCCGNPATRTQRLINGKPANYNDSIILIGAKESYE
ARCRKCHCVPKGEV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtatggacctaaaaatcatggttggatagaagtaatagttgggccgatgtatagtgga
aaatcagaggaattaatcaggcgtataaggcgtgcaaagatcgcaaagcagaaagtgcag
gtttttaaaccggaaattgataatagatacagcctagatgatgtagtatctcattgtgga
gaaaaagaggaagctatttcggtaaaaaatagtcaggaaatagtgaattttattgaagaa
gatatagatgttttagctatagacgaagtacagttttttgatgaaaatataatagatata
ttaacaaaaatttcagatagtggtaaaagagttatatgtgcaggtttggatatggacttt
agaggagaaccttttggttgtgttccaaagcttatggcaatagctgaatttgttgataaa
atacaggcaatatgcatgtgctgtggaaatccagccacaagaactcaaagactgataaac
ggtaaaccagcaaattataatgattctataatattaataggagctaaggaatcctatgag
gcacgatgcaggaaatgtcattgtgttccgaaaggtgaggtgtag

DBGET integrated database retrieval system