KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CLPA_c23760Help
Entry
CLPA_c23760       CDS       T03753                                 

Gene name
aldA
Definition
(GenBank) putative aldehyde dehydrogenase AldA
Organism
cpat  Clostridium pasteurianum DSM 525 = ATCC 6013
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJA52434
UniProt: A0A0H3J3E9
LinkDB All DBs
Position
2545127..2546623
Genome map
AA seq 498 aa AA seqDB search
MSLTNKNIENTVDKNYKLYIGGKWIDSTEKSTIKAYNPSNGKFLSEFTDASNDDVDKAVD
SAWKAFHEWKKVSREERSKILLKIADLIEENLEHLALVETLDNGKPLRETLNIDVPASAD
HFRYFAAAIRTEEGTAQDIDNSTLSIVLKEPIGVVGQVIPWNFPLLMAAWKIAPALAAGD
TIVIHPSSSTSLSLLELVKTIGDVLPAGVLNLITGKGSKSGDYMLKHKGFSKLAFTGSTE
IGYEVAKEAANKLIPATLELGGKSANIFFDDAPFEKAIEGAQLGILFNQGQVCCAGSRLF
VQEGIYDKFLASLKEAFEKVKVGLPWDNETQMGAQVNHGQLEKILNYVDIGKKEGASLIT
GGYKVNEGELSSGEFIKPTILADATNTMRIAQEEIFGPVATVIKFKDEAEVIRLANESEY
GLGGAVWTTNINRALRVAKAVETGRMWVNTYNQLPAGAPFGGYKKSGIGRETYKSILDAY
TQTKNIFINISDDKIGLY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaacaaataaaaatattgaaaatactgtagataaaaattataagctatatatt
gggggcaaatggattgacagcactgaaaaaagtactattaaggcctataatccatcgaat
ggtaaatttctctctgaatttacagacgctagcaatgacgatgtggataaagccgtagat
tcagcttggaaagcttttcacgaatggaaaaaagtaagtcgtgaggaaagaagtaaaatt
cttttaaaaatcgctgatttaattgaagaaaatttagaacacttagctctagtagaaacc
cttgataacggaaaacctttaagagaaactctaaatatagatgtaccagccagtgcagat
cattttagatattttgcagctgctataagaacagaagaaggaactgcccaagatatagat
aatagcacattgagcatagttttaaaagaacctattggtgtagttggtcaggtaattccc
tggaatttcccactgctcatggcagcttggaaaatagcaccagcccttgcagcaggagat
accatagttattcacccatcatcatctacttctctaagccttttggaacttgtaaaaact
ataggtgatgtacttcctgcaggagtattgaatctaattacaggaaaaggttctaaatct
ggagattatatgcttaaacacaaaggcttcagtaaacttgcttttactggttctacagaa
ataggttatgaagttgcaaaggaagctgccaataaacttatacctgctactttagaatta
ggtggtaaatctgcaaatatattttttgatgatgctccttttgaaaaagctattgaaggt
gctcaacttggaatacttttcaatcaaggtcaagtttgctgtgccggctcaagattattt
gttcaagaaggcatttatgataaattcctcgcctctttaaaagaagcctttgaaaaagta
aaagtaggtcttccttgggataatgaaactcaaatgggtgctcaagtaaatcatggtcaa
ttagagaagatattaaattacgtggatattggcaaaaaagaaggtgcttctcttataact
ggcggctataaggttaatgaaggtgagctttcatctggagaatttattaaaccaacaatt
cttgcagatgctacaaataccatgagaatagcccaggaggaaatatttggtcctgtagct
acagttataaagtttaaagatgaggctgaagttataaggcttgcaaatgaatctgaatat
ggtcttggtggtgcagtatggactacaaatataaatagagccttaagagtagctaaagcc
gtagaaacaggtagaatgtgggttaacacttacaatcaattacctgctggtgctcctttt
ggtggatataaaaaatctggaataggcagagaaacttataaatcaattttggatgcctat
actcagaccaaaaatatatttataaatatttcagatgacaagataggtttatattaa

DBGET integrated database retrieval system