KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CLPA_c27870Help
Entry
CLPA_c27870       CDS       T03753                                 

Definition
(GenBank) putative transketolase C-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
cpat  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
cpat00030  Pentose phosphate pathway
cpat01100  Metabolic pathways
cpat01110  Biosynthesis of secondary metabolites
cpat01120  Microbial metabolism in diverse environments
cpat01130  Biosynthesis of antibiotics
cpat01200  Carbon metabolism
cpat01230  Biosynthesis of amino acids
Module
cpat_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cpat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLPA_c27870
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CLPA_c27870
Enzymes [BR:cpat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CLPA_c27870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: AJA52842
UniProt: A0A0H3J5X4
LinkDB All DBs
Position
complement(2982424..2983386)
Genome map
AA seq 320 aa AA seqDB search
MSKKVATREAYGKALARIGSNNKKIVVLDADLSKSTKTAEFKEKCTDRFINMGIAEGNMM
SVAAGLATCGKIAFASTFAIFAAGRAFEQIRNSICYTKLNVKICATHAGITVGEDGASHQ
SVEDLSLMRSIPNMTVISPSDAVETEAAIEAIAEYQGPCYVRLGRAPVNVINDVPDYKFQ
IGKGVVLREGTDAAIVATGIMVDAALEAHDILKDQGINVKVINIHTVKPIDKELIISAAK
ETGIIVTAEEHSIIGGLGSAVCEVTGEEYPVPVLRVGIKDVFGESGKPDELLKAYNLTAQ
DIAMQVKKGINLKSNQLLFK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaaagtagccacaagagaagcttatggaaaagctttagctagaataggatca
aacaataaaaaaattgttgtgctggatgcggatttgtccaaatctactaaaacggcagag
tttaaagagaaatgcactgacagatttattaatatgggaattgcagagggtaatatgatg
tcagtagcagctggacttgctacttgtggtaaaattgcctttgctagtacttttgctata
tttgcagcaggaagagcttttgagcaaataaggaattctatttgttatactaaactgaat
gtaaagatatgtgctactcatgcgggaattacagtgggggaagatggagcgtcacatcaa
tctgtagaagatttatctttaatgagaagtatcccaaatatgactgttatatctccaagt
gatgcagttgaaacagaagcggctattgaagctatagctgaatatcagggaccttgttat
gttagacttggaagagcaccagtaaatgttataaatgatgtacctgattataaatttcaa
attggtaaaggtgttgtcttaagagaaggtacagatgcagctattgttgctacggggatt
atggtagatgcagctttagaagctcatgatatattaaaagatcaaggtataaatgttaaa
gtaattaacatacatacagtaaagcctatagataaagaattaattatttcagcagcaaaa
gaaactggtattattgtaactgcagaagagcatagcataattggaggattaggttcagca
gtttgtgaggttactggagaagaatatcctgtgcctgtgcttagagttggtattaaagat
gtatttggagaaagtggaaaaccagatgaacttttaaaagcatataatttaactgctcag
gatatagcaatgcaggttaaaaaaggtataaacttaaaaagtaatcagctgttgttcaag
taa

DBGET integrated database retrieval system